(data stored in ACNUC7421 zone)

EMBL: CR954246.PURC

CR954246.PURC        Location/Qualifiers
FT   CDS             473249..474352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="PSHAa0454"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /function="2.3.1.1 : Purine ribonucleotide biosynthesis"
FT                   /EC_number="6.3.2.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1534690; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85551"
FT                   /db_xref="GOA:Q3IFR4"
FT                   /db_xref="InterPro:IPR014106"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR4"
FT                   /protein_id="CAI85551.1"
FT                   /translation="MTSYKVLDVNDDLPIRTKGDVHSGKVRSVYWLTDADSKRLISEKG
FT                   YKVPADTELAIMVISDRISAFDCIWQGENGLNGVPGKGIALNSVAAHWFKLFDEAGLAG
FT                   NHIVDIPHPYVWIVRKASTVKVEAIARQYITGSMWRDYAKGVRDFCGINLPEGLTANQK
FT                   LDKVLITPSTKGIITGVADIPPVDDVNITRSNITNNLSVFNFRAADDVAQYEKLLVEGF
FT                   ELISGELAKLGQIFVDTKFEFGYVEDINGAEQLIYIDEVGTPDSSRIWDEASYKDGKIV
FT                   ENSKEGFRQLLINNVPESDVLLNKDRMDEREQLAKDYILPESVMLEVSNTYVGIASKIV
FT                   GKEIVIPADPRQEVIAILDADYGLIIK"
     MTSYKVLDVN DDLPIRTKGD VHSGKVRSVY WLTDADSKRL ISEKGYKVPA DTELAIMVIS        60
     DRISAFDCIW QGENGLNGVP GKGIALNSVA AHWFKLFDEA GLAGNHIVDI PHPYVWIVRK       120
     ASTVKVEAIA RQYITGSMWR DYAKGVRDFC GINLPEGLTA NQKLDKVLIT PSTKGIITGV       180
     ADIPPVDDVN ITRSNITNNL SVFNFRAADD VAQYEKLLVE GFELISGELA KLGQIFVDTK       240
     FEFGYVEDIN GAEQLIYIDE VGTPDSSRIW DEASYKDGKI VENSKEGFRQ LLINNVPESD       300
     VLLNKDRMDE REQLAKDYIL PESVMLEVSN TYVGIASKIV GKEIVIPADP RQEVIAILDA       360
     DYGLIIK                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page