(data stored in ACNUC7421 zone)

EMBL: CR954246.PURD

CR954246.PURD        Location/Qualifiers
FT   CDS             complement(355015..356304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="PSHAa0343"
FT                   /product="phosphoribosylglycinamide synthetase (GAR
FT                   synthetase)"
FT                   /function="2.3.1.1 : Purine ribonucleotide biosynthesis"
FT                   /EC_number="6.3.4.13"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85441"
FT                   /db_xref="GOA:Q3IIC5"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC5"
FT                   /protein_id="CAI85441.1"
FT                   /translation="MNVLVIGSGGREHALAFKAAQNTKVNTVFVAPGNAGTALEPKLEN
FT                   VAINVDDLDGLLQFAQQNNVELTIVGPEIPLVLGVVDKFREHGLAIFGPTAGAAQLEGS
FT                   KSFTKDFLARHNIPSGDYQTFEQVAPALAYLKEKGAPIVIKADGLAAGKGVIVAMTEAE
FT                   AEDAIRDMLAGNAFGDAGSRVVIEEFLEGEEASFIVMVDGKNVLPFATSQDHKRAYNGD
FT                   AGPNTGGMGAYSPAPVVTDEIHQRIMNEVIYPTVEGMASEGHPYTGFLYAGLMIDTDGT
FT                   PKVIEYNCRFGDPETQPMMLRLQSDLVELIEAANRVELDKTTIEFDPRAAVGVVLAAKG
FT                   YPGDYPKGDVISGLQVDYPAGEKVFHAGTKQNGNDVVTAGGRVLCATALGNTVTEAQQR
FT                   AYELIKQLSWDGMEYRTDIAYRAIAREQNS"
     MNVLVIGSGG REHALAFKAA QNTKVNTVFV APGNAGTALE PKLENVAINV DDLDGLLQFA        60
     QQNNVELTIV GPEIPLVLGV VDKFREHGLA IFGPTAGAAQ LEGSKSFTKD FLARHNIPSG       120
     DYQTFEQVAP ALAYLKEKGA PIVIKADGLA AGKGVIVAMT EAEAEDAIRD MLAGNAFGDA       180
     GSRVVIEEFL EGEEASFIVM VDGKNVLPFA TSQDHKRAYN GDAGPNTGGM GAYSPAPVVT       240
     DEIHQRIMNE VIYPTVEGMA SEGHPYTGFL YAGLMIDTDG TPKVIEYNCR FGDPETQPMM       300
     LRLQSDLVEL IEAANRVELD KTTIEFDPRA AVGVVLAAKG YPGDYPKGDV ISGLQVDYPA       360
     GEKVFHAGTK QNGNDVVTAG GRVLCATALG NTVTEAQQRA YELIKQLSWD GMEYRTDIAY       420
     RAIAREQNS                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page