(data stored in ACNUC7421 zone)

EMBL: CR954246.PURH

CR954246.PURH        Location/Qualifiers
FT   CDS             complement(357249..358835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="PSHAa0345"
FT                   /product="bifunctional purine biosynthesis protein
FT                   purH[Includes:IMP cyclohydrolase (Inosinicase) (IMP
FT                   synthetase) (ATIC);Phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase (AICAR transformylase) ]"
FT                   /function="2.3.1.1 : Purine ribonucleotide biosynthesis"
FT                   /function="2.3.3 : Sugar-nucleotide biosynthesis and
FT                   conversions"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85443"
FT                   /db_xref="GOA:Q3IIC3"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIC3"
FT                   /protein_id="CAI85443.1"
FT                   /translation="MDTHRPIRRALLSVSDKTGIVEFARALEAQGVDILSTGGTCKLLA
FT                   DNGIKVTEVSDHTGHPEIMDGRVKTLHPKIHGGILARRGQDESVMAENNISAIDIVVVN
FT                   LYPFANTVAQENCSLEDAIENIDIGGPTMVRAAAKNHKDVTIVVNASDYDRVISEMQSN
FT                   KGSTTYKTRFDLAIAAYEHTAQYDGMIANYFGKMVPDYTEEAAEDTKFPRTINMQFTKK
FT                   QDMRYGENSHQDAAFYVENDIVEASVATATQLQGKALSFNNIADTDAALECVKEFDVPA
FT                   CVIVKHANPCGVSIGSNILEAYERAFKTDPTSAFGGIIAFNQELDAATAEAIVERQFVE
FT                   VIIAPSVSDAAAKIVSAKQNVRLLVCGQWTDKAAGQDIKRVNGGILVQDRDLGMVTQGD
FT                   LKVVSKRQPTEQELKDLLFCWKVAKFVKSNAIVYARDGMTIGVGAGQMSRVYSAKIAGI
FT                   KAADENLEVKGSVMASDAFFPFRDGIDAAAAAGITAVIQPGGSMRDAEVIAAADEAGMA
FT                   MVLTGMRHFRH"
     MDTHRPIRRA LLSVSDKTGI VEFARALEAQ GVDILSTGGT CKLLADNGIK VTEVSDHTGH        60
     PEIMDGRVKT LHPKIHGGIL ARRGQDESVM AENNISAIDI VVVNLYPFAN TVAQENCSLE       120
     DAIENIDIGG PTMVRAAAKN HKDVTIVVNA SDYDRVISEM QSNKGSTTYK TRFDLAIAAY       180
     EHTAQYDGMI ANYFGKMVPD YTEEAAEDTK FPRTINMQFT KKQDMRYGEN SHQDAAFYVE       240
     NDIVEASVAT ATQLQGKALS FNNIADTDAA LECVKEFDVP ACVIVKHANP CGVSIGSNIL       300
     EAYERAFKTD PTSAFGGIIA FNQELDAATA EAIVERQFVE VIIAPSVSDA AAKIVSAKQN       360
     VRLLVCGQWT DKAAGQDIKR VNGGILVQDR DLGMVTQGDL KVVSKRQPTE QELKDLLFCW       420
     KVAKFVKSNA IVYARDGMTI GVGAGQMSRV YSAKIAGIKA ADENLEVKGS VMASDAFFPF       480
     RDGIDAAAAA GITAVIQPGG SMRDAEVIAA ADEAGMAMVL TGMRHFRH                    528
//

If you have problems or comments...

PBIL Back to PBIL home page