(data stored in ACNUC7421 zone)

EMBL: CR954246.QUEA

CR954246.QUEA        Location/Qualifiers
FT   CDS             333540..334571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="PSHAa0318"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase (Queuosine biosynthesis
FT                   protein )"
FT                   /function="3.2.3.1 : tRNA modifications"
FT                   /EC_number="2.4.2.29"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1706703; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85417"
FT                   /db_xref="GOA:Q3ILB9"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILB9"
FT                   /protein_id="CAI85417.1"
FT                   /translation="MRVADFSFDLPDELIARFPKQDRTSSRLLSLDGPSGVVEHKVFSD
FT                   LLELVNENDLLVFNNTRVIPARMFGQKASGGKVEVLVERVLDEHRVLAHVRASKSLKPG
FT                   NEVILEGKAKATMVARHDTLFELEFEHSQNVLDILNDIGHMPLPPYIDRPDNEADRERY
FT                   QTVYGEKPGAVAAPTAGLHFDDKLMTALKNKGVQMAFVTLHVGAGTFQPVRVATVDEHI
FT                   MHSEYIEVPDDVVAAVANTKANGGRVIAIGTTSVRSLESAAKVHGGKLDTYFGDTDIFI
FT                   YPGYQFNVVDAMITNFHLPESTLIMLVSAFAGQNNIMGAYNTAIEQQYRFFSYGDAMFL
FT                   TRK"
     MRVADFSFDL PDELIARFPK QDRTSSRLLS LDGPSGVVEH KVFSDLLELV NENDLLVFNN        60
     TRVIPARMFG QKASGGKVEV LVERVLDEHR VLAHVRASKS LKPGNEVILE GKAKATMVAR       120
     HDTLFELEFE HSQNVLDILN DIGHMPLPPY IDRPDNEADR ERYQTVYGEK PGAVAAPTAG       180
     LHFDDKLMTA LKNKGVQMAF VTLHVGAGTF QPVRVATVDE HIMHSEYIEV PDDVVAAVAN       240
     TKANGGRVIA IGTTSVRSLE SAAKVHGGKL DTYFGDTDIF IYPGYQFNVV DAMITNFHLP       300
     ESTLIMLVSA FAGQNNIMGA YNTAIEQQYR FFSYGDAMFL TRK                         343
//

If you have problems or comments...

PBIL Back to PBIL home page