(data stored in ACNUC7421 zone)

EMBL: CR954246.RBN

CR954246.RBN         Location/Qualifiers
FT   CDS             180651..181553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="PSHAa0171"
FT                   /product="tRNA processing exoribonuclease BN; required for
FT                   maturation of tRNA encoded by bacteriophages; dimer"
FT                   /function="3.2.2.2 : Ribonucleases"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10625642; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85274"
FT                   /db_xref="GOA:Q3IJ43"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ43"
FT                   /protein_id="CAI85274.1"
FT                   /translation="MNDKLSYYKQQVGSFLRQQPGWWMQYINRCIDDQITVNAGYLAYV
FT                   TLLSLVPLIAVGVAIFSAFPGFESTRLAIESFLFTNFVPTSSDVIKEHISSFAGNANQM
FT                   TAVGIGFLAAIALLLIRNVDATLNRIWRIKKKRPMMISFAVYWMVLSLGPVFLGGSIAV
FT                   TSYIVSLVSFADQGIPGFSGFLLKLLPYGISMVGFIMLYTLVPNTRVSFKAAIPGALFA
FT                   AMLFELTKKGFALYISHFPSYEVIYGAVATIPILFVWIYLSWIVVLLGAELTACISPEN
FT                   IEDTPEIELDEQENTKDTL"
     MNDKLSYYKQ QVGSFLRQQP GWWMQYINRC IDDQITVNAG YLAYVTLLSL VPLIAVGVAI        60
     FSAFPGFEST RLAIESFLFT NFVPTSSDVI KEHISSFAGN ANQMTAVGIG FLAAIALLLI       120
     RNVDATLNRI WRIKKKRPMM ISFAVYWMVL SLGPVFLGGS IAVTSYIVSL VSFADQGIPG       180
     FSGFLLKLLP YGISMVGFIM LYTLVPNTRV SFKAAIPGAL FAAMLFELTK KGFALYISHF       240
     PSYEVIYGAV ATIPILFVWI YLSWIVVLLG AELTACISPE NIEDTPEIEL DEQENTKDTL       300
//

If you have problems or comments...

PBIL Back to PBIL home page