(data stored in ACNUC7421 zone)

EMBL: CR954246.RDOA

CR954246.RDOA        Location/Qualifiers
FT   CDS             259246..260220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdoA"
FT                   /locus_tag="PSHAa0247"
FT                   /product="conserved hypothetical protein, putative
FT                   homoserine kinase type II"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12511488; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85350"
FT                   /db_xref="GOA:Q3ILM5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM5"
FT                   /protein_id="CAI85350.1"
FT                   /translation="MSKFSFIDLTPDLILDAIESVGIYVESGLLALNSYENRVYQFVAE
FT                   GGKRYVVKFYRPERWSEKQIQEEHDFAFELAEAEVPVVAPMEYNGQSLFEHQGYLFTLF
FT                   PSVGGRLFEVDNLDQLDVLGRLIGRMHQVAKTKPFTQRPTLTCEEYLHTAKVHLQKSNL
FT                   VPMGLETAFYTILDLVIKQAQAQYTNVKTIRLHGDCHAGNILWAGDALMFVDLDDSRQG
FT                   PPIQDLWMMLSGDRQTQLLQLDTLVTAYEEFCDFDHSQLKLIEPLRAMRIIHYMGWVAK
FT                   RWSDPAFVRNFSWFADDKYWEQQILALKEQLAALQEAPLKLLP"
     MSKFSFIDLT PDLILDAIES VGIYVESGLL ALNSYENRVY QFVAEGGKRY VVKFYRPERW        60
     SEKQIQEEHD FAFELAEAEV PVVAPMEYNG QSLFEHQGYL FTLFPSVGGR LFEVDNLDQL       120
     DVLGRLIGRM HQVAKTKPFT QRPTLTCEEY LHTAKVHLQK SNLVPMGLET AFYTILDLVI       180
     KQAQAQYTNV KTIRLHGDCH AGNILWAGDA LMFVDLDDSR QGPPIQDLWM MLSGDRQTQL       240
     LQLDTLVTAY EEFCDFDHSQ LKLIEPLRAM RIIHYMGWVA KRWSDPAFVR NFSWFADDKY       300
     WEQQILALKE QLAALQEAPL KLLP                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page