(data stored in ACNUC7421 zone)

EMBL: CR954246.RECF

CR954246.RECF        Location/Qualifiers
FT   CDS             2675..3769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="PSHAa0003"
FT                   /product="gap repair protein with nucleoside triP hydrolase
FT                   domain, part of RecFOR complex that targets RecA to
FT                   ssDNA-dsDNA junction"
FT                   /function="3.1.2 : DNA recombination"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10585965, 12718760, 12769856; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85117"
FT                   /db_xref="GOA:Q3IDE8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDE8"
FT                   /protein_id="CAI85117.1"
FT                   /translation="MSLSHLSLKYFRNIEALTLEPVNGVNIIYGENGSGKTSLLEAIYY
FT                   LSHGKSFRTSKHKSIIAHQQEQFVIHGRKAIHDLSIPIGISKTQAGETNLKIQGKASRK
FT                   ISELAQLMPVQIITPESYSLFFGGPKERRKFLDLGLFHVEHEFFFLWQSFNKVLKQRNA
FT                   LLKSKPKNYFDQIKFWDKEFVRLAEQINKLRMAYISRFKQQFFDKMCAELTLIRDLEIS
FT                   FNAGWKESESLSDALELNFERDARQGFTSKGPHKADFSFSVAGSSVENIFSRGQLKLLL
FT                   YALKVTQNSLIESETDKQSILLIDDLPSELSEDTKEKVGQLLAHCSSQIFISSILSESI
FT                   SAVVEPMQRELQMFHVKHGNLITR"
     MSLSHLSLKY FRNIEALTLE PVNGVNIIYG ENGSGKTSLL EAIYYLSHGK SFRTSKHKSI        60
     IAHQQEQFVI HGRKAIHDLS IPIGISKTQA GETNLKIQGK ASRKISELAQ LMPVQIITPE       120
     SYSLFFGGPK ERRKFLDLGL FHVEHEFFFL WQSFNKVLKQ RNALLKSKPK NYFDQIKFWD       180
     KEFVRLAEQI NKLRMAYISR FKQQFFDKMC AELTLIRDLE ISFNAGWKES ESLSDALELN       240
     FERDARQGFT SKGPHKADFS FSVAGSSVEN IFSRGQLKLL LYALKVTQNS LIESETDKQS       300
     ILLIDDLPSE LSEDTKEKVG QLLAHCSSQI FISSILSESI SAVVEPMQRE LQMFHVKHGN       360
     LITR                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page