(data stored in ACNUC7421 zone)

EMBL: CR954246.RECJ

CR954246.RECJ        Location/Qualifiers
FT   CDS             529691..531412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="PSHAa0516"
FT                   /product="Single-stranded-DNA-specific exonuclease, 5'-->
FT                   3'-specific"
FT                   /function="3.1.6 : Degradation of DNA"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2649886; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85606"
FT                   /db_xref="GOA:Q3ILD9"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD9"
FT                   /protein_id="CAI85606.1"
FT                   /translation="MKKTIQTRENVDDSHLPSHLHPVIKQIYATRNVSHADELNNSAAT
FT                   LHDFKLFKDMDKACDLLIEALHAQSHILIVGDFDADGATSTATLMQGLAMFGFAHLDYL
FT                   VPDRFSLGYGLSPALAAQIVQLKPDLVITVDNGISCIAGIDIVKAANIKVLVTDHHLQG
FT                   ETLPNADAIVNPNRHDCSFPSKSIAGVGVAFYLLIALRSTLREQNHFAQQPMPNLADLL
FT                   DIVALGTVADVVALDANNRTLVHQGLARIRSGKTRPGITALIEVANRNASRLSASDFGF
FT                   SLAPRLNAAGRLDDMSLGIACLLSTDINQARRIASELDSLNFARREIEQGMQHEAQAVL
FT                   DKLAFNDDNIPDAICLYQEDWHQGVIGILAGRLKEKYHRPTVIFAGGENGEIKGSCRSI
FT                   EGLHIRDLLEGLSTADPHLISKFGGHAMAAGLSINEQQFSEFKHAFDTAVSAQLSEESK
FT                   RCIVFTDGELPNECFTMDFAQQLKQAGPWGQQFPEPVFEHTFELIQQRIVGEKHLKLVL
FT                   KHQSGRLVDAIAFGIDVKEWPDNNAQFVKAAYQLDINEFRGKFTLQLIIRELEKAS"
     MKKTIQTREN VDDSHLPSHL HPVIKQIYAT RNVSHADELN NSAATLHDFK LFKDMDKACD        60
     LLIEALHAQS HILIVGDFDA DGATSTATLM QGLAMFGFAH LDYLVPDRFS LGYGLSPALA       120
     AQIVQLKPDL VITVDNGISC IAGIDIVKAA NIKVLVTDHH LQGETLPNAD AIVNPNRHDC       180
     SFPSKSIAGV GVAFYLLIAL RSTLREQNHF AQQPMPNLAD LLDIVALGTV ADVVALDANN       240
     RTLVHQGLAR IRSGKTRPGI TALIEVANRN ASRLSASDFG FSLAPRLNAA GRLDDMSLGI       300
     ACLLSTDINQ ARRIASELDS LNFARREIEQ GMQHEAQAVL DKLAFNDDNI PDAICLYQED       360
     WHQGVIGILA GRLKEKYHRP TVIFAGGENG EIKGSCRSIE GLHIRDLLEG LSTADPHLIS       420
     KFGGHAMAAG LSINEQQFSE FKHAFDTAVS AQLSEESKRC IVFTDGELPN ECFTMDFAQQ       480
     LKQAGPWGQQ FPEPVFEHTF ELIQQRIVGE KHLKLVLKHQ SGRLVDAIAF GIDVKEWPDN       540
     NAQFVKAAYQ LDINEFRGKF TLQLIIRELE KAS                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page