(data stored in ACNUC7421 zone)

EMBL: CR954246.RECX

CR954246.RECX        Location/Qualifiers
FT   CDS             546352..546804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="PSHAa0531"
FT                   /product="putative regulatory protein, inhibitor of RecA
FT                   recombinase and coprotease activities"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /function="3.1.2 : DNA recombination"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8165147, 12547390; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85620"
FT                   /db_xref="GOA:Q3ILF4"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILF4"
FT                   /protein_id="CAI85620.1"
FT                   /translation="MDDKLKQKLKNYVLWLLSRQEYSRRELTFKLQKKEATDEFIETLL
FT                   DWCEKHNFVNEQRYCEGFVRKHIFKCHGLRRIQSEAMGKGIDRSLLEKVIEELEVDWFE
FT                   LAQDAYNKKYSNTPADLEYKDKAKRVRYLMYRGFSYDEIDFAMQAQ"
     MDDKLKQKLK NYVLWLLSRQ EYSRRELTFK LQKKEATDEF IETLLDWCEK HNFVNEQRYC        60
     EGFVRKHIFK CHGLRRIQSE AMGKGIDRSL LEKVIEELEV DWFELAQDAY NKKYSNTPAD       120
     LEYKDKAKRV RYLMYRGFSY DEIDFAMQAQ                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page