(data stored in ACNUC7421 zone)

EMBL: CR954246.RFFE

CR954246.RFFE        Location/Qualifiers
FT   CDS             complement(485171..486241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rffE"
FT                   /locus_tag="PSHAa0466"
FT                   /product="UDP-N-acetyl glucosamine-2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7559340; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85563"
FT                   /db_xref="GOA:Q3IFQ3"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ3"
FT                   /protein_id="CAI85563.1"
FT                   /translation="MAPLVHALTNDSRFEAKVCVTAQHREMLDQVLELFKITPDYDLNL
FT                   MKAGQTLPEVTSRILLELTPVLKEFKPDVVLVHGDTATTFAASLAAYYEQIAVGHVEAG
FT                   LRTGNIYSPWPEEGNRKLTGSLTKYHLAPTENSKANLLKENHAAENISVTGNTVIDALL
FT                   MVKQQIENDAELSNTLASQFPMLDENKKLILVTGHRRESFGGGFERICEALAQTAKTHP
FT                   NTQILYPVHLNPNVQEPVKRILKDVDNVHLIEPQQYLPFVYLMNRAHIILTDSGGIQEE
FT                   APSLGKPVLVMRDTTERPEAVEAGTVKLVGTDVAKITAALNELLTDDAAYKTMSRAHNP
FT                   YGDGNACQRICDILAR"
     MAPLVHALTN DSRFEAKVCV TAQHREMLDQ VLELFKITPD YDLNLMKAGQ TLPEVTSRIL        60
     LELTPVLKEF KPDVVLVHGD TATTFAASLA AYYEQIAVGH VEAGLRTGNI YSPWPEEGNR       120
     KLTGSLTKYH LAPTENSKAN LLKENHAAEN ISVTGNTVID ALLMVKQQIE NDAELSNTLA       180
     SQFPMLDENK KLILVTGHRR ESFGGGFERI CEALAQTAKT HPNTQILYPV HLNPNVQEPV       240
     KRILKDVDNV HLIEPQQYLP FVYLMNRAHI ILTDSGGIQE EAPSLGKPVL VMRDTTERPE       300
     AVEAGTVKLV GTDVAKITAA LNELLTDDAA YKTMSRAHNP YGDGNACQRI CDILAR           356
//

If you have problems or comments...

PBIL Back to PBIL home page