(data stored in ACNUC7421 zone)

EMBL: CR954246.RHLB

CR954246.RHLB        Location/Qualifiers
FT   CDS             120724..121986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlB"
FT                   /locus_tag="PSHAa0114"
FT                   /product="ATP-dependent RNA helicase with nucleoside triP
FT                   hydrolase domain, putative cold-shock protein"
FT                   /function="3.2.2 : Processing and degradation of RNA"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14981237; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85223"
FT                   /db_xref="GOA:Q3IDI9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI9"
FT                   /protein_id="CAI85223.1"
FT                   /translation="MTDKKFSDFAIAPEVVAGLTESGFEYCTPIQAKCLPFICEGRDIA
FT                   GQAQTGTGKTLAFLTATCHRLLQSSKAPSKHPRALIMAPTRELAIQIHKDAKILAPHCN
FT                   LNLGLVYGGEDYEKQRAQLEKGVDILIGTTGRLIDLYKQGCYTLNEIEVVVLDEADRMF
FT                   DLGFIKDIRYMFHRMPDTSKRLNLLFSATLSYRVQELAFEHMTNPEHVQIEPDVKTGKR
FT                   IQEELFHPSQEDKIKLLLTLIEEEWPEKAIIFANTKHSCETVYAWLKADGHRVGMLTGD
FT                   VNQKKRQSILAEFSKGDLDFLVATDVAARGLHIPEVSHVFNFDLPDDCEDYVHRIGRTA
FT                   RAGASGHAISFACEQYAYNLHEIEEYIDHSIPLSHYDKTALLDDLTKPTIHRKRNFSTG
FT                   PRNRSNNSGRRPNNSYQKGRS"
     MTDKKFSDFA IAPEVVAGLT ESGFEYCTPI QAKCLPFICE GRDIAGQAQT GTGKTLAFLT        60
     ATCHRLLQSS KAPSKHPRAL IMAPTRELAI QIHKDAKILA PHCNLNLGLV YGGEDYEKQR       120
     AQLEKGVDIL IGTTGRLIDL YKQGCYTLNE IEVVVLDEAD RMFDLGFIKD IRYMFHRMPD       180
     TSKRLNLLFS ATLSYRVQEL AFEHMTNPEH VQIEPDVKTG KRIQEELFHP SQEDKIKLLL       240
     TLIEEEWPEK AIIFANTKHS CETVYAWLKA DGHRVGMLTG DVNQKKRQSI LAEFSKGDLD       300
     FLVATDVAAR GLHIPEVSHV FNFDLPDDCE DYVHRIGRTA RAGASGHAIS FACEQYAYNL       360
     HEIEEYIDHS IPLSHYDKTA LLDDLTKPTI HRKRNFSTGP RNRSNNSGRR PNNSYQKGRS       420
//

If you have problems or comments...

PBIL Back to PBIL home page