(data stored in ACNUC7421 zone)

EMBL: CR954246.RIBA

CR954246.RIBA        Location/Qualifiers
FT   CDS             544927..545550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="PSHAa0529"
FT                   /product="GTP cyclohydrolase II"
FT                   /function="2.5.8 : Riboflavin, FMN, and FAD"
FT                   /EC_number="3.5.4.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8320220; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85618"
FT                   /db_xref="GOA:Q3IJ00"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ00"
FT                   /protein_id="CAI85618.1"
FT                   /translation="MAQVRARVQLNVGKNSDIPAEIISFTDLKDGKEHIAMVFNNADTE
FT                   QDVPLIRMHSECLTGDVFYSSRCDCGEQLNECIEMMHEQGGILLYLRQEGRGIGLYNKI
FT                   DAYVLQSQGMNTYEANNHLGFADDLRDFSDAVLMLNALNLPHVKLMTNNPKKLNALRDA
FT                   GITVDSVVGTHAHIKAGVAGNKAYLETKIKHGAHMLDIKKIKKP"
     MAQVRARVQL NVGKNSDIPA EIISFTDLKD GKEHIAMVFN NADTEQDVPL IRMHSECLTG        60
     DVFYSSRCDC GEQLNECIEM MHEQGGILLY LRQEGRGIGL YNKIDAYVLQ SQGMNTYEAN       120
     NHLGFADDLR DFSDAVLMLN ALNLPHVKLM TNNPKKLNAL RDAGITVDSV VGTHAHIKAG       180
     VAGNKAYLET KIKHGAHMLD IKKIKKP                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page