(data stored in ACNUC7421 zone)

EMBL: CR954246.RNK

CR954246.RNK         Location/Qualifiers
FT   CDS             complement(272118..272603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk"
FT                   /locus_tag="PSHAa0258"
FT                   /product="putative regulator of nucleoside diphosphate
FT                   kinase"
FT                   /function="2.3.3 : Sugar-nucleotide biosynthesis and
FT                   conversions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 7565093; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85357"
FT                   /db_xref="GOA:Q3IDT1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDT1"
FT                   /protein_id="CAI85357.1"
FT                   /translation="MQLSLCRIILRVSFIYINIIKDIELNKRPEIIISSLDADRLYDLI
FT                   ESLPANSFAGEKELEAELGRATIVDPKDVPATIVTMNSTVNFVVESSKEEFNLTLVYPK
FT                   DLDASGQKISILAPIGGALLGLSQGDEIEWPKPGGGLIKVKIKEVTYQPERVGELHR"
     MQLSLCRIIL RVSFIYINII KDIELNKRPE IIISSLDADR LYDLIESLPA NSFAGEKELE        60
     AELGRATIVD PKDVPATIVT MNSTVNFVVE SSKEEFNLTL VYPKDLDASG QKISILAPIG       120
     GALLGLSQGD EIEWPKPGGG LIKVKIKEVT YQPERVGELH R                           161
//

If you have problems or comments...

PBIL Back to PBIL home page