(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLA

CR954246.RPLA        Location/Qualifiers
FT   CDS             226109..226813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="PSHAa0219"
FT                   /product="50S ribosomal subunit protein L1"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 365581, 7556101, 3298242; Product type s : structural
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85322"
FT                   /db_xref="GOA:Q3ILQ3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILQ3"
FT                   /protein_id="CAI85322.1"
FT                   /translation="MAKLTKRMRTIREKVEVTKDYEINEAIALLKELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPNGTGRDVRVAVFTQGANAEAAKEAGAELVGMEDLAELV
FT                   KKGEMNFDVVVASPDAMRVVGQLGQILGPRGLMPNPKTGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFTAEQLQQNLESLIVALKKAKPSQAKGVYVKKVSISTTMGAGV
FT                   AVDQNTLSTTVA"
     MAKLTKRMRT IREKVEVTKD YEINEAIALL KELATAKFVE SVDVAVNLGI DARKSDQNVR        60
     GATVLPNGTG RDVRVAVFTQ GANAEAAKEA GAELVGMEDL AELVKKGEMN FDVVVASPDA       120
     MRVVGQLGQI LGPRGLMPNP KTGTVTPNVA EAVKNAKAGQ VRYRNDKNGI IHTTIGKVDF       180
     TAEQLQQNLE SLIVALKKAK PSQAKGVYVK KVSISTTMGA GVAVDQNTLS TTVA             234
//

If you have problems or comments...

PBIL Back to PBIL home page