(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLB

CR954246.RPLB        Location/Qualifiers
FT   CDS             158157..158981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="PSHAa0147"
FT                   /product="50S ribosomal protein L2"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3892488, 7556101, 3298242, 11013226; Product type s :
FT                   structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85251"
FT                   /db_xref="GOA:Q3IF22"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF22"
FT                   /protein_id="CAI85251.1"
FT                   /translation="MALQKCKPTSAGRRHLVKVVNSDLHKGKPYAPLLEKNSKSGGRNN
FT                   NGRITVRHIGGGHKQHYRLIDFKRTKDGIPATVERLEYDPNRSANIALVLYADGERRYI
FT                   IAPKGLKAGDAIQSGVDAPIKPGNALPMRNMPVGSTVHNVELKPGKGAQIARSAGAYVQ
FT                   ILARDGQYVTLRLRSGEVRKVEADCRATLGEVGNAEHMLRSLGKAGANRWRGIRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVSPWGKPTKGAKTRKNKRTDKFIVRRRTK"
     MALQKCKPTS AGRRHLVKVV NSDLHKGKPY APLLEKNSKS GGRNNNGRIT VRHIGGGHKQ        60
     HYRLIDFKRT KDGIPATVER LEYDPNRSAN IALVLYADGE RRYIIAPKGL KAGDAIQSGV       120
     DAPIKPGNAL PMRNMPVGST VHNVELKPGK GAQIARSAGA YVQILARDGQ YVTLRLRSGE       180
     VRKVEADCRA TLGEVGNAEH MLRSLGKAGA NRWRGIRPTV RGVAMNPVDH PHGGGEGRTS       240
     GGRHPVSPWG KPTKGAKTRK NKRTDKFIVR RRTK                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page