(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLC

CR954246.RPLC        Location/Qualifiers
FT   CDS             156584..157219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="PSHAa0144"
FT                   /product="50S ribosomal subunit protein L3"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9813114, 11847124; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85248"
FT                   /db_xref="GOA:Q3IF25"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF25"
FT                   /protein_id="CAI85248.1"
FT                   /translation="MALGLVGRKVGMTRIFTEDGVSIPVTVIEATPNRIAQIKSEATDG
FT                   YNALQVTAGTKKASRVNKASAGHFAKAGVEAGRGLWEFRLNGGEGDFEVGAELTVELFN
FT                   EINKVDVTGTSKGKGFQGGVKRWNFSMQDATHGNSLSHRAPGSIGQNQSPGKVFKGKKM
FT                   AGHMGAERVTTQNLELVRVDAERNLLLVKGAVPGAIGGDVIVKPAVKA"
     MALGLVGRKV GMTRIFTEDG VSIPVTVIEA TPNRIAQIKS EATDGYNALQ VTAGTKKASR        60
     VNKASAGHFA KAGVEAGRGL WEFRLNGGEG DFEVGAELTV ELFNEINKVD VTGTSKGKGF       120
     QGGVKRWNFS MQDATHGNSL SHRAPGSIGQ NQSPGKVFKG KKMAGHMGAE RVTTQNLELV       180
     RVDAERNLLL VKGAVPGAIG GDVIVKPAVK A                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page