(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLD

CR954246.RPLD        Location/Qualifiers
FT   CDS             157237..157842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="PSHAa0145"
FT                   /product="50S ribosomal subunit protein L4"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 13130133; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85249"
FT                   /db_xref="GOA:Q3IF24"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF24"
FT                   /protein_id="CAI85249.1"
FT                   /translation="MELAIKDASGGLEVSEATFGREFNEALVHQVVVAYAAGARQGTRA
FT                   QKTRSEVSGGGKKPWAQKGTGRARAGTIRSPIWRSGGVSFAAKPQDHSQKVNRKMYRGA
FT                   IKSILSELVRQERLIVVESFALAAPKTKELVAKLKELELKDVLIVTEEVDENLFLSARN
FT                   LYKVDTRDVAGIDPVSLIAFDKVLITAAAVKQLEEALA"
     MELAIKDASG GLEVSEATFG REFNEALVHQ VVVAYAAGAR QGTRAQKTRS EVSGGGKKPW        60
     AQKGTGRARA GTIRSPIWRS GGVSFAAKPQ DHSQKVNRKM YRGAIKSILS ELVRQERLIV       120
     VESFALAAPK TKELVAKLKE LELKDVLIVT EEVDENLFLS ARNLYKVDTR DVAGIDPVSL       180
     IAFDKVLITA AAVKQLEEAL A                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page