(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLJ

CR954246.RPLJ        Location/Qualifiers
FT   CDS             227136..227630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="PSHAa0220"
FT                   /product="50S ribosomal protein L10"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 377281, 782920, 2448482; Product type s : structural
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85323"
FT                   /db_xref="GOA:Q3ILQ2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILQ2"
FT                   /protein_id="CAI85323.1"
FT                   /translation="MALNLQGKQAIVAEVNEAANGALSAVVADSRGVTVGAITALRKEA
FT                   RANGVWMKVVRNTLAKRALEGTQFECLSDSFVGPSLIAFSSEHPGAAARIFSAFAKKNE
FT                   KFELKTAAFEGNVVDAAMLATLPTYDEAVARLMSAMKEASAGKLCKTIEAVRVQKEEQA
FT                   A"
     MALNLQGKQA IVAEVNEAAN GALSAVVADS RGVTVGAITA LRKEARANGV WMKVVRNTLA        60
     KRALEGTQFE CLSDSFVGPS LIAFSSEHPG AAARIFSAFA KKNEKFELKT AAFEGNVVDA       120
     AMLATLPTYD EAVARLMSAM KEASAGKLCK TIEAVRVQKE EQAA                        164
//

If you have problems or comments...

PBIL Back to PBIL home page