(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLK

CR954246.RPLK        Location/Qualifiers
FT   CDS             225676..226104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="PSHAa0218"
FT                   /product="50S ribosomal subunit protein L11"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11244072, 11673421; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85321"
FT                   /db_xref="GOA:Q3ILQ4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILQ4"
FT                   /protein_id="CAI85321.1"
FT                   /translation="MAKKVEALIKLQVNAGMANPSPPVGPALGQHGVNIMEFCKAFNAR
FT                   TESIEKGAPVPVVISVYGDRSFTFDMKTPPAAYLLLKAAGVKSGSGRPNTEKVGTVTRA
FT                   QLEEIVETKRADLTASDLEAAVRTIAGSARAMGLSVED"
     MAKKVEALIK LQVNAGMANP SPPVGPALGQ HGVNIMEFCK AFNARTESIE KGAPVPVVIS        60
     VYGDRSFTFD MKTPPAAYLL LKAAGVKSGS GRPNTEKVGT VTRAQLEEIV ETKRADLTAS       120
     DLEAAVRTIA GSARAMGLSV ED                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page