(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLL

CR954246.RPLL        Location/Qualifiers
FT   CDS             227705..228067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="PSHAa0221"
FT                   /product="50S ribosomal subunit protein L7/L12"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2660100, 168924, 8234320, 10747797; Product type s :
FT                   structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85324"
FT                   /db_xref="GOA:Q3ILQ0"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILQ0"
FT                   /protein_id="CAI85324.1"
FT                   /translation="MSVSKDQILDAIAEMSVMDVVALIEAMEEKFGVTAAAGMVAGPAA
FT                   EAVEEKTEFDVILTGAGANKVSAIKAVRSATGLGLKEAKALVEAAPTPVKEGISKEEAE
FT                   ALAKDLTEAGAEVEVK"
     MSVSKDQILD AIAEMSVMDV VALIEAMEEK FGVTAAAGMV AGPAAEAVEE KTEFDVILTG        60
     AGANKVSAIK AVRSATGLGL KEAKALVEAA PTPVKEGISK EEAEALAKDL TEAGAEVEVK       120
//

If you have problems or comments...

PBIL Back to PBIL home page