(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLP

CR954246.RPLP        Location/Qualifiers
FT   CDS             160348..160761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="PSHAa0151"
FT                   /product="50S ribosomal subunit protein L16"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85255"
FT                   /db_xref="GOA:Q3IF18"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF18"
FT                   /protein_id="CAI85255.1"
FT                   /translation="MLQPKRTKFRKTHKGRNRGLAQNGNKVSFGTFGLKATGRGRMTAR
FT                   QIEAARRAMTRHVKRQGKIWIRVFPDKPITNKPLEVRMGKGKGSVEYWVAEIQPGKVLY
FT                   EMEGVSEELAREAFDLAARKLPFKTTFVTRTVM"
     MLQPKRTKFR KTHKGRNRGL AQNGNKVSFG TFGLKATGRG RMTARQIEAA RRAMTRHVKR        60
     QGKIWIRVFP DKPITNKPLE VRMGKGKGSV EYWVAEIQPG KVLYEMEGVS EELAREAFDL       120
     AARKLPFKTT FVTRTVM                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page