(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLV

CR954246.RPLV        Location/Qualifiers
FT   CDS             159289..159621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="PSHAa0149"
FT                   /product="50S ribosomal subunit protein L22"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11468402, 13130133; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85253"
FT                   /db_xref="GOA:Q3IF20"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF20"
FT                   /protein_id="CAI85253.1"
FT                   /translation="MQALAKHKFASGSAQKARLVADQIRGLPVDRALEILAYSPKKAAV
FT                   LVKKVLESAIANAEHNEGADIDELRITTIFVDDGPTMKRIMPRAKGRADRILKRTSHIT
FT                   VMVSDS"
     MQALAKHKFA SGSAQKARLV ADQIRGLPVD RALEILAYSP KKAAVLVKKV LESAIANAEH        60
     NEGADIDELR ITTIFVDDGP TMKRIMPRAK GRADRILKRT SHITVMVSDS                  110
//

If you have problems or comments...

PBIL Back to PBIL home page