(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLW

CR954246.RPLW        Location/Qualifiers
FT   CDS             157839..158141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="PSHAa0146"
FT                   /product="50S ribosomal subunit protein L23"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1960726, 12756233; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85250"
FT                   /db_xref="GOA:Q3IF23"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF23"
FT                   /protein_id="CAI85250.1"
FT                   /translation="MIREERLLKVIVAPHISEKSTIAAEENNTIVFKVAKDSTKAEVKA
FT                   AVEKLFEVEVTGVRTLNVKGKTKRTGARFGRRNDWKKAYVTLKEGSELDFVGGAE"
     MIREERLLKV IVAPHISEKS TIAAEENNTI VFKVAKDSTK AEVKAAVEKL FEVEVTGVRT        60
     LNVKGKTKRT GARFGRRNDW KKAYVTLKEG SELDFVGGAE                             100
//

If you have problems or comments...

PBIL Back to PBIL home page