(data stored in ACNUC7421 zone)

EMBL: CR954246.RPOB

CR954246.RPOB        Location/Qualifiers
FT   CDS             228338..232363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="PSHAa0222"
FT                   /product="DNA-directed RNA polymerase beta chain (RNAP beta
FT                   subunit) (Transcriptase beta chain) (RNA polymerase beta
FT                   subunit)"
FT                   /function="3.2.1.3.1 : RNA polymerase (core enzyme)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6266829; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85325"
FT                   /db_xref="GOA:Q3ILP9"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP9"
FT                   /protein_id="CAI85325.1"
FT                   /translation="MAYSYSEKKRIRKDFGKRPQVLDIPFLLSTQLKSFKKFLVPDADG
FT                   DHGLEAAFRSVFPIKSYSGNSELQYVSYRIGEPVFDVKECQIRGVTYSAPLRVKLRLVV
FT                   MDKEAPGTVKDIKEQEVYMGEIPLMTDTGTFVINGTERVIVSQLHRSPGVFFDNDRGKT
FT                   HSSGKVLYNARVIPYRGSWLDFEFDAKDNLYVRIDRRRKLPASIILRALEYSSEDILGI
FT                   FFDNTTFEVTDGKVLMELVPSRLRGETAAFDIKSEDGEVFVESGRRVTARHIKNIEKKG
FT                   IKQLEVPHEYIIGRVLAKNYVDESTGEVVANANDELTLELMAELVKAGHTKIDTLYINE
FT                   VDSGAYMSNTLNIDSSSSRLEALVEIYRMMRPGEPPTKDAAEALFQNLFFSEERYDLST
FT                   VGRMKFNSRVGYDTDTGPGTLSKEDIVSVMKVLIAIRNGVGDVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVRERLSLGDLDAIMPQDLINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHVTHYGRVCPIETPEGPNIGLINSLS
FT                   TYARTNDYGFLETPYRKVVDGVVTDEVDYLSAIEEGQFVIAQANSNLTETNEFVDELIP
FT                   CRHKGESTFMGRMDQQYMDVSPQQVISVAAALIPFLEHDDANRALMGSNMQRQAVPTLK
FT                   ADKPLVGTGIELTLAKDSGVTIVAKRGGEVMYCDASRIVVNVHEEERVPGEAGIDIYNL
FT                   TKYTRSNQNTCINQKPTCMVGEPVTRGDVLADGPSTDLGDLALGQNLRVAFMPWNGYNF
FT                   EDSILLSERVVEEDRLTTIHIQELQCIARDTKLGSEEITADIPNVGESALGKLDESGVV
FT                   YIGAEVKSGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNSVTGTVID
FT                   VQVFTRDGVEKDKRALEVEEMQLRDAKKDFNEEFRILEAGVLDRARKLLIAAGFDEDKL
FT                   ALLNAEKLLTQSLAEEDKQAELEQLAAQYDELKAEYDKKFENKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRCIQPGDKMAGRHGNKGVISTIVPVEDMPYDDKGRTVDIVLNPLGVPSRM
FT                   NIGQILETHMGLAARGIGERIEEMMKEQRELHELRAFIKQAYEIGESRQVVDIDSFTDD
FT                   EIRRLAENLKGGLPIATPAFDGAKENEIKDMLELAGYPRSGQVTLYDGRTGDQFERQVT
FT                   VGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAY
FT                   TLQEMLTVKSDDVNGRTKMYKNIVDGNHKMEPGMPESFNVLLKEIRSLGINIELEEN"
     MAYSYSEKKR IRKDFGKRPQ VLDIPFLLST QLKSFKKFLV PDADGDHGLE AAFRSVFPIK        60
     SYSGNSELQY VSYRIGEPVF DVKECQIRGV TYSAPLRVKL RLVVMDKEAP GTVKDIKEQE       120
     VYMGEIPLMT DTGTFVINGT ERVIVSQLHR SPGVFFDNDR GKTHSSGKVL YNARVIPYRG       180
     SWLDFEFDAK DNLYVRIDRR RKLPASIILR ALEYSSEDIL GIFFDNTTFE VTDGKVLMEL       240
     VPSRLRGETA AFDIKSEDGE VFVESGRRVT ARHIKNIEKK GIKQLEVPHE YIIGRVLAKN       300
     YVDESTGEVV ANANDELTLE LMAELVKAGH TKIDTLYINE VDSGAYMSNT LNIDSSSSRL       360
     EALVEIYRMM RPGEPPTKDA AEALFQNLFF SEERYDLSTV GRMKFNSRVG YDTDTGPGTL       420
     SKEDIVSVMK VLIAIRNGVG DVDDIDHLGN RRIRSVGEMA ENQFRVGLVR VERAVRERLS       480
     LGDLDAIMPQ DLINAKPISA AVKEFFGSSQ LSQFMDQNNP LSEVTHKRRI SALGPGGLTR       540
     ERAGFEVRDV HVTHYGRVCP IETPEGPNIG LINSLSTYAR TNDYGFLETP YRKVVDGVVT       600
     DEVDYLSAIE EGQFVIAQAN SNLTETNEFV DELIPCRHKG ESTFMGRMDQ QYMDVSPQQV       660
     ISVAAALIPF LEHDDANRAL MGSNMQRQAV PTLKADKPLV GTGIELTLAK DSGVTIVAKR       720
     GGEVMYCDAS RIVVNVHEEE RVPGEAGIDI YNLTKYTRSN QNTCINQKPT CMVGEPVTRG       780
     DVLADGPSTD LGDLALGQNL RVAFMPWNGY NFEDSILLSE RVVEEDRLTT IHIQELQCIA       840
     RDTKLGSEEI TADIPNVGES ALGKLDESGV VYIGAEVKSG DILVGKVTPK GETQLTPEEK       900
     LLRAIFGEKA SDVKDSSLRV PNSVTGTVID VQVFTRDGVE KDKRALEVEE MQLRDAKKDF       960
     NEEFRILEAG VLDRARKLLI AAGFDEDKLA LLNAEKLLTQ SLAEEDKQAE LEQLAAQYDE      1020
     LKAEYDKKFE NKRRKITQGD DLAPGVLKIV KVYLAVKRCI QPGDKMAGRH GNKGVISTIV      1080
     PVEDMPYDDK GRTVDIVLNP LGVPSRMNIG QILETHMGLA ARGIGERIEE MMKEQRELHE      1140
     LRAFIKQAYE IGESRQVVDI DSFTDDEIRR LAENLKGGLP IATPAFDGAK ENEIKDMLEL      1200
     AGYPRSGQVT LYDGRTGDQF ERQVTVGYMY MLKLNHLVDD KMHARSTGSY SLVTQQPLGG      1260
     KAQFGGQRFG EMEVWALEAY GAAYTLQEML TVKSDDVNGR TKMYKNIVDG NHKMEPGMPE      1320
     SFNVLLKEIR SLGINIELEE N                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page