(data stored in ACNUC7421 zone)

EMBL: CR954246.RPOC

CR954246.RPOC        Location/Qualifiers
FT   CDS             232468..236640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="PSHAa0223"
FT                   /product="RNA polymerase, beta prime subunit"
FT                   /function="3.2.1.3.1 : RNA polymerase (core enzyme)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6287430, 6278450; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85326"
FT                   /db_xref="GOA:Q3ILP8"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP8"
FT                   /protein_id="CAI85326.1"
FT                   /translation="MKDLLKFLKQQNKTEEFDAIRIGLASPDMVRSWSYGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTLTKVRRDRMGH
FT                   IDLASPVAHIWFLKSLPSRIGLMLDMTLRDIERVLYFESFVVTEPGMTTLERGQLLGEE
FT                   EYLDALEEHGDEFEAKMGAEAVLDLLRELDLAQLIAEMREELPTINSETKRKKITKRLK
FT                   LMESFHQSGNNPEWMIMTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPTLKLHQCGLPKKMALELFKPFIYGKLERRGMATTIKAAKK
FT                   MVEREMPEVWDVLDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIHLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTIEAQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDR
FT                   INAKGEGAIFKDPKEAEKAYRSGNADLHAIVKVRISQSVKNENGVVEDTITVIDTTVGR
FT                   AILSLILPKGMPYESINQPLGKKQISGLINECYRRLGLKDTVMFADQIMYTGFHYAMKS
FT                   GVSIGIDDLVIPPVKAQIIESAEAEVTEINQQFQSGLVTAGEKYNKVIDIWSRVNENLS
FT                   REMMSNLSKDTVINAQGEEVEQASFNSVFMMADSGARGSAAQIRQLAGMRGLMARPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVINED
FT                   DCGTEDGLTMKPLIEGGDVVEALRERVLGRVVAEDIVIPGTNTVLVERNIMLDEKLCDL
FT                   LEEHSVDEVRVRSVITCDNDFGVCANCYGRDLARGHIINAGESVGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRASAENNVQVKTNGTLKLHNAKYVLNTDGKIAIISRSTEITIIDSYG
FT                   REKERYKVPYGAVLTVQDNAEVQGNDIVATWDPHSHPIVLEHKSKVSFSDIDDSNTETQ
FT                   TDELTGLTRIVVKDLSKANAKEPKLIIESEERGLQETRLPSFTTIEVVDGTTVNPGDVL
FT                   ARIPQEGSKTRDITGGLPRVADLFEARKPKEPAILAEVTGTISFGKETKGKKRLVITPD
FT                   EGDHYEEMIPKWRQLNVFEGERVSKGEVIADGPESPHDILRLRGVTHVANYIVNEVQEV
FT                   YRLQGVKINDKHIETIIRQMLRKCTIMHGGDTDFLAGEQIEVARVNIANRDLEAQGKIP
FT                   AKFEIQLMGITKASLATESFISAASFQETTRVLTDAAVNGKSDELRGLKENVIVGRLIP
FT                   AGTGFSYHQERMARRKQRNVVEEQTVSAEEATQALTDALNADLSGNQ"
     MKDLLKFLKQ QNKTEEFDAI RIGLASPDMV RSWSYGEVKK PETINYRTFK PERDGLFCAR        60
     IFGPVKDYEC LCGKYKRLKH RGVICEKCGV EVTLTKVRRD RMGHIDLASP VAHIWFLKSL       120
     PSRIGLMLDM TLRDIERVLY FESFVVTEPG MTTLERGQLL GEEEYLDALE EHGDEFEAKM       180
     GAEAVLDLLR ELDLAQLIAE MREELPTINS ETKRKKITKR LKLMESFHQS GNNPEWMIMT       240
     VLPVLPPDLR PLVPLDGGRF ATSDLNDLYR RVINRNNRLK RLLDLAAPDI IVRNEKRMLQ       300
     EAVDALLDNG RRGRAITGSN KRPLKSLADM IKGKQGRFRQ NLLGKRVDYS GRSVITVGPT       360
     LKLHQCGLPK KMALELFKPF IYGKLERRGM ATTIKAAKKM VEREMPEVWD VLDEVIREHP       420
     VLLNRAPTLH RLGIQAFEPV LIEGKAIHLH PLVCAAYNAD FDGDQMAVHV PLTIEAQLEA       480
     RALMMSTNNI LSPANGEPII VPSQDVVLGL YYMTRDRINA KGEGAIFKDP KEAEKAYRSG       540
     NADLHAIVKV RISQSVKNEN GVVEDTITVI DTTVGRAILS LILPKGMPYE SINQPLGKKQ       600
     ISGLINECYR RLGLKDTVMF ADQIMYTGFH YAMKSGVSIG IDDLVIPPVK AQIIESAEAE       660
     VTEINQQFQS GLVTAGEKYN KVIDIWSRVN ENLSREMMSN LSKDTVINAQ GEEVEQASFN       720
     SVFMMADSGA RGSAAQIRQL AGMRGLMARP DGSIIETPIT ANFREGLNVL QYFISTHGAR       780
     KGLADTALKT ANSGYLTRRL VDVAQDLVIN EDDCGTEDGL TMKPLIEGGD VVEALRERVL       840
     GRVVAEDIVI PGTNTVLVER NIMLDEKLCD LLEEHSVDEV RVRSVITCDN DFGVCANCYG       900
     RDLARGHIIN AGESVGVIAA QSIGEPGTQL TMRTFHIGGA ASRASAENNV QVKTNGTLKL       960
     HNAKYVLNTD GKIAIISRST EITIIDSYGR EKERYKVPYG AVLTVQDNAE VQGNDIVATW      1020
     DPHSHPIVLE HKSKVSFSDI DDSNTETQTD ELTGLTRIVV KDLSKANAKE PKLIIESEER      1080
     GLQETRLPSF TTIEVVDGTT VNPGDVLARI PQEGSKTRDI TGGLPRVADL FEARKPKEPA      1140
     ILAEVTGTIS FGKETKGKKR LVITPDEGDH YEEMIPKWRQ LNVFEGERVS KGEVIADGPE      1200
     SPHDILRLRG VTHVANYIVN EVQEVYRLQG VKINDKHIET IIRQMLRKCT IMHGGDTDFL      1260
     AGEQIEVARV NIANRDLEAQ GKIPAKFEIQ LMGITKASLA TESFISAASF QETTRVLTDA      1320
     AVNGKSDELR GLKENVIVGR LIPAGTGFSY HQERMARRKQ RNVVEEQTVS AEEATQALTD      1380
     ALNADLSGNQ                                                             1390
//

If you have problems or comments...

PBIL Back to PBIL home page