(data stored in ACNUC7421 zone)

EMBL: CR954246.RPOH

CR954246.RPOH        Location/Qualifiers
FT   CDS             371499..372362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="PSHAa0357"
FT                   /product="RNA polymerase sigma-32 factor (Heat shock
FT                   regulatory protein F33.4)"
FT                   /function="3.2.1.2.1 : Sigma factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2841288, 6387714; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85455"
FT                   /db_xref="GOA:Q3IIB1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB1"
FT                   /protein_id="CAI85455.1"
FT                   /translation="MSKDLYAMALTVGQQSASMDGYLQAVSTIPMLKVEQEQELATRLQ
FT                   EEGDLSAAKQLIMSHLRFVAHIAKGYSGYGLPQADLIQEGNIGLMKAVKRFNPEVGVRL
FT                   VSFAVHWIKAEIHEFVLKNWRIVKVATTKAQRKLFFNLRKNKKRLGWFNQAEVSTVASE
FT                   LGVSEKEVREMESRMSGQDMGFDLTGDDDDSAPSSTYSPVQYLTDGTADLADDIEQQQW
FT                   QEQSHTRLFSALKTLDERSQDIVSARWLTDDKATLQELAEKYSVSAERVRQLEKTAMKK
FT                   LQAAMV"
     MSKDLYAMAL TVGQQSASMD GYLQAVSTIP MLKVEQEQEL ATRLQEEGDL SAAKQLIMSH        60
     LRFVAHIAKG YSGYGLPQAD LIQEGNIGLM KAVKRFNPEV GVRLVSFAVH WIKAEIHEFV       120
     LKNWRIVKVA TTKAQRKLFF NLRKNKKRLG WFNQAEVSTV ASELGVSEKE VREMESRMSG       180
     QDMGFDLTGD DDDSAPSSTY SPVQYLTDGT ADLADDIEQQ QWQEQSHTRL FSALKTLDER       240
     SQDIVSARWL TDDKATLQEL AEKYSVSAER VRQLEKTAMK KLQAAMV                     287
//

If you have problems or comments...

PBIL Back to PBIL home page