(data stored in ACNUC7421 zone)

EMBL: CR954246.RPSC

CR954246.RPSC        Location/Qualifiers
FT   CDS             159634..160335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="PSHAa0150"
FT                   /product="30S ribosomal subunit protein S3"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2459390, 2657655, 6380588; Product type s : structural
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85254"
FT                   /db_xref="GOA:Q3IF19"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF19"
FT                   /protein_id="CAI85254.1"
FT                   /translation="MGQKVHPTGIRLGISKPWVSTWYASSKDFSAQLFGDHKVRTFLTK
FT                   ELKTASVSKIVIERPAKSIRVTIHTARPGVVIGKKGEDVEKLRQAVTKIAGVPAQINIS
FT                   EVRKPELDAQLVADGIASQLERRVMFRRAMKRSVQNAMRIGSKGIKVEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYATSEALTTYGIIGVKVWIFKGEVIGGLPLVQEQEKPAK
FT                   RAPKKAKKSAK"
     MGQKVHPTGI RLGISKPWVS TWYASSKDFS AQLFGDHKVR TFLTKELKTA SVSKIVIERP        60
     AKSIRVTIHT ARPGVVIGKK GEDVEKLRQA VTKIAGVPAQ INISEVRKPE LDAQLVADGI       120
     ASQLERRVMF RRAMKRSVQN AMRIGSKGIK VEVSGRLGGA EIARTEWYRE GRVPLHTLRA       180
     DIDYATSEAL TTYGIIGVKV WIFKGEVIGG LPLVQEQEKP AKRAPKKAKK SAK              233
//

If you have problems or comments...

PBIL Back to PBIL home page