(data stored in ACNUC7421 zone)

EMBL: CR954246.RPSG

CR954246.RPSG        Location/Qualifiers
FT   CDS             237306..237776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="PSHAa0225"
FT                   /product="30S ribosomal subunit protein S7"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 385062, 7556101; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85328"
FT                   /db_xref="GOA:Q3ILP6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP6"
FT                   /protein_id="CAI85328.1"
FT                   /translation="MPRRRVIGQRKILPDPKFGSELLAKFVNIVMLDGKKSTAEKIVYG
FT                   ALNVAAEKSGKSHLEIFETALDNIRPQVEVKSRRVGGSTYQVPVEVRPVRRNALGMRWL
FT                   VDAARKRGEKSMGLRLAQEIVDAADNKGTAVKKREDVHRMAEANKAFAHYRW"
     MPRRRVIGQR KILPDPKFGS ELLAKFVNIV MLDGKKSTAE KIVYGALNVA AEKSGKSHLE        60
     IFETALDNIR PQVEVKSRRV GGSTYQVPVE VRPVRRNALG MRWLVDAARK RGEKSMGLRL       120
     AQEIVDAADN KGTAVKKRED VHRMAEANKA FAHYRW                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page