(data stored in ACNUC7421 zone)

EMBL: CR954246.RPSJ

CR954246.RPSJ        Location/Qualifiers
FT   CDS             156245..156556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="PSHAa0143"
FT                   /product="30S ribosomal subunit protein S10 (NusE protein)"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10383769, 10498727; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85247"
FT                   /db_xref="GOA:Q3IF26"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF26"
FT                   /protein_id="CAI85247.1"
FT                   /translation="MSNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   FERFTVLTSPHVNKDARDQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISLG"
     MSNQRIRIRL KAFDHRLIDQ STAEIVETAK RTGAQVRGPI PLPTRFERFT VLTSPHVNKD        60
     ARDQYEIRTH KRLIDIVEPT DKTVDALMRL DLAAGVDVQI SLG                         103
//

If you have problems or comments...

PBIL Back to PBIL home page