(data stored in ACNUC7421 zone)

EMBL: CR954246.RPSL

CR954246.RPSL        Location/Qualifiers
FT   CDS             236833..237207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="PSHAa0224"
FT                   /product="30S ribosomal protein S12"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 320034, 7556101, 8844851; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85327"
FT                   /db_xref="GOA:Q3ILP7"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP7"
FT                   /protein_id="CAI85327.1"
FT                   /translation="MATINQLVRKPRRSKVTKSNSAALKACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRFHTVRGALDC
FT                   AGVSDRRQARSKYGTKRPKG"
     MATINQLVRK PRRSKVTKSN SAALKACPQK RGVCTRVYTT TPKKPNSALR KVARVRLTNG        60
     FEVTSYIGGE GHNLQEHSVI LIRGGRVKDL PGVRFHTVRG ALDCAGVSDR RQARSKYGTK       120
     RPKG                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page