(data stored in ACNUC7421 zone)

EMBL: CR954246.RPSQ

CR954246.RPSQ        Location/Qualifiers
FT   CDS             160952..161209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="PSHAa0153"
FT                   /product="30S ribosomal subunit protein S17"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11985624, 12051911, 14654705; Product type s : structural
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85257"
FT                   /db_xref="GOA:Q3IFM3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFM3"
FT                   /protein_id="CAI85257.1"
FT                   /translation="MSDKIRTLQGRVISDKMEKSFTIAIARYVKHPIYGKFIRRTTKLH
FT                   VHDENNEVQAGDVVTIRECAPISKSKSWTFVAVIERPKQA"
     MSDKIRTLQG RVISDKMEKS FTIAIARYVK HPIYGKFIRR TTKLHVHDEN NEVQAGDVVT        60
     IRECAPISKS KSWTFVAVIE RPKQA                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page