(data stored in ACNUC7421 zone)

EMBL: CR954246.RPSS

CR954246.RPSS        Location/Qualifiers
FT   CDS             158985..159275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="PSHAa0148"
FT                   /product="30S ribosomal protein S19"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3892488, 348496, 3279034, 12244297; Product type s :
FT                   structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85252"
FT                   /db_xref="GOA:Q3IF21"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF21"
FT                   /protein_id="CAI85252.1"
FT                   /translation="MRNSHATFSQEGSFYRPTLLKKVEKALESGDKKPIKTWSRRSMII
FT                   PNMIGLTIAVHNGRQHVPVFITDEMIGHKLGEFAPTRTYRGHAADKKAKKR"
     MRNSHATFSQ EGSFYRPTLL KKVEKALESG DKKPIKTWSR RSMIIPNMIG LTIAVHNGRQ        60
     HVPVFITDEM IGHKLGEFAP TRTYRGHAAD KKAKKR                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page