(data stored in ACNUC7421 zone)

EMBL: CR954246.RSMC

CR954246.RSMC        Location/Qualifiers
FT   CDS             complement(567820..568845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmC"
FT                   /locus_tag="PSHAa0552"
FT                   /product="putative ribosomal RNA small subunit
FT                   methyltransferase C"
FT                   /function="3.2.3.2 : rRNA modifications"
FT                   /EC_number="2.1.1.52"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 9873033; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85640"
FT                   /db_xref="GOA:Q3ILJ2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILJ2"
FT                   /protein_id="CAI85640.1"
FT                   /translation="MSVLTNPSLLLLRNSEKLVGKSILVVNFVQDGFLAELKKRNPESK
FT                   ITAFSYNHANGEFAKNTPGVDVCVNHCISGNDFDLVILYYPKSKPEVLMALDNIRAVIT
FT                   ADAELLVVGENKSGVKSIEKQLTDKANFSNKIDSAKHCVLYSFAELKQLSQFNISDYHK
FT                   PFTVSVADSEFTAISIPGVFNHGNLDVGTKILLENAPLIKQGTVLDFGCGAGLIATYLG
FT                   LQNPALSFVCSDVSALAIYATTQTLKLNNIKGEALLSDGLTNITGKFDLIISNPPFHTG
FT                   IATDYTVAETFLANAKQHLTKAGKLNIVANSFLKYPPILEAQFDNYQTVFKNNKFAVYS
FT                   S"
     MSVLTNPSLL LLRNSEKLVG KSILVVNFVQ DGFLAELKKR NPESKITAFS YNHANGEFAK        60
     NTPGVDVCVN HCISGNDFDL VILYYPKSKP EVLMALDNIR AVITADAELL VVGENKSGVK       120
     SIEKQLTDKA NFSNKIDSAK HCVLYSFAEL KQLSQFNISD YHKPFTVSVA DSEFTAISIP       180
     GVFNHGNLDV GTKILLENAP LIKQGTVLDF GCGAGLIATY LGLQNPALSF VCSDVSALAI       240
     YATTQTLKLN NIKGEALLSD GLTNITGKFD LIISNPPFHT GIATDYTVAE TFLANAKQHL       300
     TKAGKLNIVA NSFLKYPPIL EAQFDNYQTV FKNNKFAVYS S                           341
//

If you have problems or comments...

PBIL Back to PBIL home page