(data stored in ACNUC7421 zone)

EMBL: CR954246.RSUA

CR954246.RSUA        Location/Qualifiers
FT   CDS             complement(486414..487112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsuA"
FT                   /locus_tag="PSHAa0467"
FT                   /product="16S rRNA pseudouridylate 516 synthase"
FT                   /function="3.2.3.2 : rRNA modifications"
FT                   /EC_number="4.2.1.70"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7612632; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85564"
FT                   /db_xref="GOA:Q3IFQ2"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ2"
FT                   /protein_id="CAI85564.1"
FT                   /translation="MKFPCRLDKFISHLAELPRSKARASIKRQAALVNGEVVTAFDFQI
FT                   KQQDEVVFQGEQLVFLGKRYFMLNKPVGYVSANSDELHKTVFDLIDEPNMSDFHVAGRL
FT                   DIDTTGLVILTNDGDWSHKITSPKNNKFKTYLVETQEPITDESLDALREGVQLHNEKAL
FT                   TRPAKAERLANYGLRLSICEGKYHQVKRMLAAVDNKVVELHREQIGNIKLDENLAAGEY
FT                   RLLTAEEIKL"
     MKFPCRLDKF ISHLAELPRS KARASIKRQA ALVNGEVVTA FDFQIKQQDE VVFQGEQLVF        60
     LGKRYFMLNK PVGYVSANSD ELHKTVFDLI DEPNMSDFHV AGRLDIDTTG LVILTNDGDW       120
     SHKITSPKNN KFKTYLVETQ EPITDESLDA LREGVQLHNE KALTRPAKAE RLANYGLRLS       180
     ICEGKYHQVK RMLAAVDNKV VELHREQIGN IKLDENLAAG EYRLLTAEEI KL               232
//

If you have problems or comments...

PBIL Back to PBIL home page