(data stored in ACNUC7421 zone)

EMBL: CR954246.SDAC

CR954246.SDAC        Location/Qualifiers
FT   CDS             complement(211123..212382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaC"
FT                   /locus_tag="PSHAa0200"
FT                   /product="putative serine transport protein (HAAAP family)"
FT                   /function="1.2.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8026499; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85303"
FT                   /db_xref="GOA:Q3IFT3"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT3"
FT                   /protein_id="CAI85303.1"
FT                   /translation="MPPSQDATHFNASTAKQSSWTLHDTQWTLSLFGTAVGAGILFLPI
FT                   NIGIGGFWPLIIMACLAFPMTFLAHRGLARFVLSSKNKDADFTDVVEEHFGVTAGRLIS
FT                   LLYFLSIFPILLIYGVGLTNTVDSFMVNQLGMESPSRVLLSGVLVAGMIGLMMGGEKLM
FT                   LRAFAILVYPLVGILFFLSLYLIPSWQMPNMALPEVGSFGKTLWLSIPIIVFSFSHAAA
FT                   ISSFVNVQRGHYGNKAVAKSEAILKRTSLLLITFVLLFVFSCVLSLTGEQMAAAKAANV
FT                   SVLSYLANITDNSFIATLGPLVAFIAIMSSFLGHFLGARESFTGLVTKQSNISAKVADK
FT                   VGAVLMFFAIWFCAVKNPSILDMMDQLSGPIIAMILFIMPMIAVYKVPALHKHRNRLST
FT                   LFILAVGSMAVMALLYSMLK"
     MPPSQDATHF NASTAKQSSW TLHDTQWTLS LFGTAVGAGI LFLPINIGIG GFWPLIIMAC        60
     LAFPMTFLAH RGLARFVLSS KNKDADFTDV VEEHFGVTAG RLISLLYFLS IFPILLIYGV       120
     GLTNTVDSFM VNQLGMESPS RVLLSGVLVA GMIGLMMGGE KLMLRAFAIL VYPLVGILFF       180
     LSLYLIPSWQ MPNMALPEVG SFGKTLWLSI PIIVFSFSHA AAISSFVNVQ RGHYGNKAVA       240
     KSEAILKRTS LLLITFVLLF VFSCVLSLTG EQMAAAKAAN VSVLSYLANI TDNSFIATLG       300
     PLVAFIAIMS SFLGHFLGAR ESFTGLVTKQ SNISAKVADK VGAVLMFFAI WFCAVKNPSI       360
     LDMMDQLSGP IIAMILFIMP MIAVYKVPAL HKHRNRLSTL FILAVGSMAV MALLYSMLK        419
//

If you have problems or comments...

PBIL Back to PBIL home page