(data stored in ACNUC7421 zone)

EMBL: CR954246.SECB

CR954246.SECB        Location/Qualifiers
FT   CDS             385351..385839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="PSHAa0369"
FT                   /product="molecular chaperone in protein export, enhances
FT                   activity of SecA (General Secretory Pathway)"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12427258, 14517549, 15010547; Product type mc : molecular
FT                   chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85467"
FT                   /db_xref="GOA:Q3IIE1"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIE1"
FT                   /protein_id="CAI85467.1"
FT                   /translation="MNEETQNAAAQQETGAQFTIQRIYTKDVSFETPNSPAIFQKEWTP
FT                   EVKLDLDTRSNKLDEGVFEVVLALTVTASIGEETAFLCEIQQAGIFTIADVEETQLAHM
FT                   LGAFCPNVLFPYAREAVSNLVNRGTFPQLNLAPVNFDALFAQYMQQRTAQAEQASVDA"
     MNEETQNAAA QQETGAQFTI QRIYTKDVSF ETPNSPAIFQ KEWTPEVKLD LDTRSNKLDE        60
     GVFEVVLALT VTASIGEETA FLCEIQQAGI FTIADVEETQ LAHMLGAFCP NVLFPYAREA       120
     VSNLVNRGTF PQLNLAPVNF DALFAQYMQQ RTAQAEQASV DA                          162
//

If you have problems or comments...

PBIL Back to PBIL home page