(data stored in ACNUC7421 zone)

EMBL: CR954246.SECE

CR954246.SECE        Location/Qualifiers
FT   CDS             224525..224902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="PSHAa0216"
FT                   /product="preprotein translocase, membrane component,
FT                   transport across inner membrane (General Secretory
FT                   Pathway)"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11867527, 11976315, 12167867, 12941690, 12950181; Product
FT                   type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85319"
FT                   /db_xref="GOA:Q3ILQ6"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILQ6"
FT                   /protein_id="CAI85319.1"
FT                   /translation="MSTNVETPSSAMESVKWLVAIVLLAGAVVGNHMFADQSVLLRAIG
FT                   VVVAIAAGLAIASQTAKGRTFLTFAKEARIEVRKVIWPTRQETIHTTLIVMVATAIMAL
FT                   ILWGLDGILFRAVGFLTGLEI"
     MSTNVETPSS AMESVKWLVA IVLLAGAVVG NHMFADQSVL LRAIGVVVAI AAGLAIASQT        60
     AKGRTFLTFA KEARIEVRKV IWPTRQETIH TTLIVMVATA IMALILWGLD GILFRAVGFL       120
     TGLEI                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page