(data stored in ACNUC7421 zone)

EMBL: CR954246.SLT

CR954246.SLT         Location/Qualifiers
FT   CDS             15000..16886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slt"
FT                   /locus_tag="PSHAa0012"
FT                   /product="secreted lytic murein transglycosylase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /EC_number="3.2.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8765311; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85126"
FT                   /db_xref="GOA:Q3IJ22"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ22"
FT                   /protein_id="CAI85126.1"
FT                   /translation="MKKYLLNAMAAVFIFPLHCVEANIDNDAFLDAEKKVRYGDYQDFK
FT                   MAISNLDHPLKPYVEKVYWQRHPDIKHQAEIEDYLTIYQHTPLEWPVRKAWLSYLEKHN
FT                   KKAAYIRNYRKTSDTELTCTYLDYQLDLGAPEKAIFNQVTDLWTVGKSQPKACDGLFSL
FT                   WRKKGYMSKEAVWQRVTMAAEGGTQSLLPYLKTLLPSNEGYLADLYLKVRRDPSAAAGL
FT                   YRYKNKSVKEGQIALYGVKRLIWRDKELALKAWEKLEQIFTYSDAAKADVYYTFALSLA
FT                   SSGHKQASFWLNKVPKDRQDSKLIQWQLGNMLKTQDWEGIAAFFTGKDNLSLGQQYWLA
FT                   YSYAKRGEQQKADAIWKTVAANRDYYGFLAAARLGLPVDLNNQPLVVDQALVNKVKNAP
FT                   GYKRAKAFYELERFTSARREWNYLTNTSSDEEKLAASILSTELGWHDSTIFTLAKIKAW
FT                   DNVEQRFPFAFQDVFERYSKRSKIDVAWSIAIARRESSFAPDARSSANARGLMQLLPST
FT                   ADYVNKGSVSSRRLYQPQTNIRLGTRYLQYLKKKNHGNEILATASYNAGYHRIKRWLPD
FT                   EAIPAELWIELIPYRETRDYVKNVFAYRQVYHTRLHREGNILAPLLEMKMGG"
     MKKYLLNAMA AVFIFPLHCV EANIDNDAFL DAEKKVRYGD YQDFKMAISN LDHPLKPYVE        60
     KVYWQRHPDI KHQAEIEDYL TIYQHTPLEW PVRKAWLSYL EKHNKKAAYI RNYRKTSDTE       120
     LTCTYLDYQL DLGAPEKAIF NQVTDLWTVG KSQPKACDGL FSLWRKKGYM SKEAVWQRVT       180
     MAAEGGTQSL LPYLKTLLPS NEGYLADLYL KVRRDPSAAA GLYRYKNKSV KEGQIALYGV       240
     KRLIWRDKEL ALKAWEKLEQ IFTYSDAAKA DVYYTFALSL ASSGHKQASF WLNKVPKDRQ       300
     DSKLIQWQLG NMLKTQDWEG IAAFFTGKDN LSLGQQYWLA YSYAKRGEQQ KADAIWKTVA       360
     ANRDYYGFLA AARLGLPVDL NNQPLVVDQA LVNKVKNAPG YKRAKAFYEL ERFTSARREW       420
     NYLTNTSSDE EKLAASILST ELGWHDSTIF TLAKIKAWDN VEQRFPFAFQ DVFERYSKRS       480
     KIDVAWSIAI ARRESSFAPD ARSSANARGL MQLLPSTADY VNKGSVSSRR LYQPQTNIRL       540
     GTRYLQYLKK KNHGNEILAT ASYNAGYHRI KRWLPDEAIP AELWIELIPY RETRDYVKNV       600
     FAYRQVYHTR LHREGNILAP LLEMKMGG                                          628
//

If you have problems or comments...

PBIL Back to PBIL home page