(data stored in ACNUC7421 zone)

EMBL: CR954246.SLYDB

CR954246.SLYDB       Location/Qualifiers
FT   CDS             complement(306021..306515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyDB"
FT                   /locus_tag="PSHAa0292"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FkbP family"
FT                   /function="3.3.7 : Protein folding"
FT                   /EC_number="5.2.1.8"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9350861; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85391"
FT                   /db_xref="GOA:Q3IEX6"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEX6"
FT                   /protein_id="CAI85391.1"
FT                   /translation="MQISKNSAVEFHYTLSEAGEQIETSTNEAPLTYIHGSEGMLPGLE
FT                   NALEGKAAGEKFSVTLAPSESYGERVDNLVQRIPLKHLQTQSKVKVWKPGMTAMVSSDQ
FT                   GRHQVTIIKVGRFNADCDLNHPFAGKTLTFDVEVVSVREATSEEVSHGHVHAAGGCGHS
FT                   H"
     MQISKNSAVE FHYTLSEAGE QIETSTNEAP LTYIHGSEGM LPGLENALEG KAAGEKFSVT        60
     LAPSESYGER VDNLVQRIPL KHLQTQSKVK VWKPGMTAMV SSDQGRHQVT IIKVGRFNAD       120
     CDLNHPFAGK TLTFDVEVVS VREATSEEVS HGHVHAAGGC GHSH                        164
//

If you have problems or comments...

PBIL Back to PBIL home page