(data stored in ACNUC7421 zone)

EMBL: CR954246.SMF

CR954246.SMF         Location/Qualifiers
FT   CDS             28157..29245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smf"
FT                   /locus_tag="PSHAa0025"
FT                   /product="conserved protein of unknown function ; Smf
FT                   protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85139"
FT                   /db_xref="GOA:Q3IDI0"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI0"
FT                   /protein_id="CAI85139.1"
FT                   /translation="MDQSSGKLAHWLAFYMCKGLGIKTLLALSKNHSLESLFGLSHQQL
FT                   LQLGLSANQATNLLHTNWQQITHYEQLILHNNITVISIFDAAYPEDLKQIASAPLLLFC
FT                   KGDVSFLTSPQIAIVGSRNATPTGLEIAAEFAYQLTLAGITITSGMARGIDGAAHKGAL
FT                   AGSGKTIAVLGTGVDIYYPKQHKLLTNQVLEQGLLVSEFLPGTAANAHNFPRRNRIISG
FT                   LSLGVLIVEAEIKSGSLITVRYALEQNKEVFAVPGSIKNPLAQASHFLIKQGAKLVENV
FT                   SDILDEVSFAYQSGFLTPEQSTQTNKDSQCEVLNSIGFEVTSVDDIVRRAQWPIDKVQA
FT                   RLLDLELDDQIERVLDGYIRVC"
     MDQSSGKLAH WLAFYMCKGL GIKTLLALSK NHSLESLFGL SHQQLLQLGL SANQATNLLH        60
     TNWQQITHYE QLILHNNITV ISIFDAAYPE DLKQIASAPL LLFCKGDVSF LTSPQIAIVG       120
     SRNATPTGLE IAAEFAYQLT LAGITITSGM ARGIDGAAHK GALAGSGKTI AVLGTGVDIY       180
     YPKQHKLLTN QVLEQGLLVS EFLPGTAANA HNFPRRNRII SGLSLGVLIV EAEIKSGSLI       240
     TVRYALEQNK EVFAVPGSIK NPLAQASHFL IKQGAKLVEN VSDILDEVSF AYQSGFLTPE       300
     QSTQTNKDSQ CEVLNSIGFE VTSVDDIVRR AQWPIDKVQA RLLDLELDDQ IERVLDGYIR       360
     VC                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page