(data stored in ACNUC7421 zone)

EMBL: CR954246.SMG

CR954246.SMG         Location/Qualifiers
FT   CDS             29531..30004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smg"
FT                   /locus_tag="PSHAa0026"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85140"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDH9"
FT                   /protein_id="CAI85140.1"
FT                   /translation="MFEVLMYLFENYIHNDAGLFIEPNELTDELLRAGFNQAEIFKALD
FT                   WLEQLAELQHSDTSPYLITDSPQTMRIFTDHECKMLDVQCRNFLMFVERIGVTNGITRE
FT                   MVMDRLAALDKSFIGLDDLKWVVLMVLFNIPGAEVACEQMEDLIFDQPGDLLH"
     MFEVLMYLFE NYIHNDAGLF IEPNELTDEL LRAGFNQAEI FKALDWLEQL AELQHSDTSP        60
     YLITDSPQTM RIFTDHECKM LDVQCRNFLM FVERIGVTNG ITREMVMDRL AALDKSFIGL       120
     DDLKWVVLMV LFNIPGAEVA CEQMEDLIFD QPGDLLH                                157
//

If you have problems or comments...

PBIL Back to PBIL home page