(data stored in ACNUC7421 zone)

EMBL: CR954246.SNAA

CR954246.SNAA        Location/Qualifiers
FT   CDS             complement(217080..218804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="snaA"
FT                   /locus_tag="PSHAa0210"
FT                   /product="putative sodium/sulfate symporter"
FT                   /function="1.2.2 : Anions"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 10939241; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85313"
FT                   /db_xref="GOA:Q3ILR2"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILR2"
FT                   /protein_id="CAI85313.1"
FT                   /translation="MVDQLILTGIMLTLVGCLFGTRLNPAWLFVGAIGSSYLAGLIDLE
FT                   SMLVNYTNPSLITLVLLILVSIAIEKTTLIQKLAQSLSSGSLVKSVTKLGLSTAFLSSF
FT                   TNNTAVVASLITAIKDNPNHSPSKLLLPLSYTAILGGTITLIGTSTNLIVNGFAVDAGM
FT                   APLGFFDFTLVGLGALSVGLITILVMLKYLPDNGKSDQEVVPFYLEGKVQAGSKLIGRT
FT                   VEENGLRELKDLFLGEIIRDNQRICAVTPQQIIKQNDILLFVGDIKSVPLLTRFDGLKV
FT                   VHDNHQKDIEHLVEVVVSQSSKFIGKTVKEARFREQFHAAVIAIRRGHDRLQGGLGQVR
FT                   LQAGDSLILAPGKNFYSLPNLKREFVYISGFDLQTHLAPKQSNIVLLSFAAVLGLSIIG
FT                   LVPLVKGLLVLLIGFMLCGTIKLSEVKRRFPIELLAVVGSAIGLAKLMIGTGLAGQISA
FT                   AMFVVLGDFGPYSAFIAIFLMTVLFTELITNNAAAALSFPVAYSLAVGFNVDPLPFIMA
FT                   VAFGASASFISPFGYQTNLMVYSAGNYRLKDYVVMGLPLSIIYSITVLTLIPLVFPF"
     MVDQLILTGI MLTLVGCLFG TRLNPAWLFV GAIGSSYLAG LIDLESMLVN YTNPSLITLV        60
     LLILVSIAIE KTTLIQKLAQ SLSSGSLVKS VTKLGLSTAF LSSFTNNTAV VASLITAIKD       120
     NPNHSPSKLL LPLSYTAILG GTITLIGTST NLIVNGFAVD AGMAPLGFFD FTLVGLGALS       180
     VGLITILVML KYLPDNGKSD QEVVPFYLEG KVQAGSKLIG RTVEENGLRE LKDLFLGEII       240
     RDNQRICAVT PQQIIKQNDI LLFVGDIKSV PLLTRFDGLK VVHDNHQKDI EHLVEVVVSQ       300
     SSKFIGKTVK EARFREQFHA AVIAIRRGHD RLQGGLGQVR LQAGDSLILA PGKNFYSLPN       360
     LKREFVYISG FDLQTHLAPK QSNIVLLSFA AVLGLSIIGL VPLVKGLLVL LIGFMLCGTI       420
     KLSEVKRRFP IELLAVVGSA IGLAKLMIGT GLAGQISAAM FVVLGDFGPY SAFIAIFLMT       480
     VLFTELITNN AAAALSFPVA YSLAVGFNVD PLPFIMAVAF GASASFISPF GYQTNLMVYS       540
     AGNYRLKDYV VMGLPLSIIY SITVLTLIPL VFPF                                   574
//

If you have problems or comments...

PBIL Back to PBIL home page