(data stored in ACNUC7421 zone)

EMBL: CR954246.SPED

CR954246.SPED        Location/Qualifiers
FT   CDS             210227..211039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="PSHAa0199"
FT                   /product="S-adenosylmethionine decarboxylase, proenzyme"
FT                   /function="2.2.2 : Polyamines biosynthesis"
FT                   /EC_number="4.1.1.50"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10844697, 10939241; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85302"
FT                   /db_xref="GOA:Q3IFT4"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFT4"
FT                   /protein_id="CAI85302.1"
FT                   /translation="MNKPFDKLKLHGFNNLTKSLSFSIYDICYAKTEQQRKEYIEYIDE
FT                   QYSADRLTDILGEVVDIIGANILNVARQDYEPQGASVTILVSEEPVEEQQNYDADEAPG
FT                   PLPDSVVAHLDKSHICVHTYPEAHPDDGICTFRADIEVSTCGIISPLKALNFLIHSLES
FT                   DVVTIDYRVRGFTRDINGVKHYIDHAISSIQNFMTEDTKEAYQMMDVNVYQENLFHTKM
FT                   MLKETDLNTYLFGLSTDDLSDEEEEEIRSKLTREMQEIFYGRNLPDLD"
     MNKPFDKLKL HGFNNLTKSL SFSIYDICYA KTEQQRKEYI EYIDEQYSAD RLTDILGEVV        60
     DIIGANILNV ARQDYEPQGA SVTILVSEEP VEEQQNYDAD EAPGPLPDSV VAHLDKSHIC       120
     VHTYPEAHPD DGICTFRADI EVSTCGIISP LKALNFLIHS LESDVVTIDY RVRGFTRDIN       180
     GVKHYIDHAI SSIQNFMTED TKEAYQMMDV NVYQENLFHT KMMLKETDLN TYLFGLSTDD       240
     LSDEEEEEIR SKLTREMQEI FYGRNLPDLD                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page