(data stored in ACNUC7421 zone)

EMBL: CR954246.SRMB

CR954246.SRMB        Location/Qualifiers
FT   CDS             complement(524696..525922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srmB"
FT                   /locus_tag="PSHAa0510"
FT                   /product="ATP-dependent RNA helicase"
FT                   /function="3.2.3 : RNA modification"
FT                   /EC_number="2.7.7.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 2461520; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85600"
FT                   /db_xref="GOA:Q3IG81"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028621"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG81"
FT                   /protein_id="CAI85600.1"
FT                   /translation="MQFSEFDLDNKLLDAINKMGYETPTSIQQQAIPEALQGRDILASA
FT                   PTGTGKTAAFLIPAIQYLLDFPRRDPGFARVLVMTPTRELAYQIHEQCELLAKRTNLKI
FT                   GVVTGGINYGTHKEIFEKNNDILIATPGRLMEYLETENFHAEHVEMLIIDEADRMLDMG
FT                   FKKEMSRICDEAKNRRQCFLFSATLEGDSVERFAETTLNDPALLEAESSRKEKAKIHQW
FT                   VHLADDYHHKLELLVNTLNGPDVTKAIVFVKTRERLETLIGELTTNDVKAAWLRGEMPQ
FT                   DKRMKAMENFHSGKTRILVATDVAARGIDVADISHVINFDLPRTADIYVHRIGRTGRAG
FT                   KKGIAISLVEAHDIGILYKIERYIEQKLKRRVIKGLEPKHKEAKPPAKKRKDPVKMKAK
FT                   KKAKVKKKK"
     MQFSEFDLDN KLLDAINKMG YETPTSIQQQ AIPEALQGRD ILASAPTGTG KTAAFLIPAI        60
     QYLLDFPRRD PGFARVLVMT PTRELAYQIH EQCELLAKRT NLKIGVVTGG INYGTHKEIF       120
     EKNNDILIAT PGRLMEYLET ENFHAEHVEM LIIDEADRML DMGFKKEMSR ICDEAKNRRQ       180
     CFLFSATLEG DSVERFAETT LNDPALLEAE SSRKEKAKIH QWVHLADDYH HKLELLVNTL       240
     NGPDVTKAIV FVKTRERLET LIGELTTNDV KAAWLRGEMP QDKRMKAMEN FHSGKTRILV       300
     ATDVAARGID VADISHVINF DLPRTADIYV HRIGRTGRAG KKGIAISLVE AHDIGILYKI       360
     ERYIEQKLKR RVIKGLEPKH KEAKPPAKKR KDPVKMKAKK KAKVKKKK                    408
//

If you have problems or comments...

PBIL Back to PBIL home page