(data stored in ACNUC7421 zone)

EMBL: CR954246.SSEA

CR954246.SSEA        Location/Qualifiers
FT   CDS             478765..479595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sseA"
FT                   /locus_tag="PSHAa0459"
FT                   /product="putative 3-mercaptopyruvate sulfurtransferase"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /EC_number="2.8.1.2"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85556"
FT                   /db_xref="GOA:Q3IFQ9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ9"
FT                   /protein_id="CAI85556.1"
FT                   /translation="MKNIITNEQLYTQLNDPTLILFDAGMLRPGITGNYVAKAVLPNAQ
FT                   RFDIKNELADRSNPLPNTLCSETQFTQAMQKAGVNHDSLVVIYEDAGLFSAARAWWMFK
FT                   AMGFNNVKVLSGGLAKWLELGLPVESNYTQASLKGDFIAQYRPDYFIDKKQVLSATKDA
FT                   NTVILDARAYERFTGKSSEPRAGMRSGHIINSYSLPLTSLLENGEAKSLDFIQAKFSEL
FT                   VGNATHLQFSCGSGVTACALALFADECGYSNLSVYDGSWSEWGADNSLPIAVGG"
     MKNIITNEQL YTQLNDPTLI LFDAGMLRPG ITGNYVAKAV LPNAQRFDIK NELADRSNPL        60
     PNTLCSETQF TQAMQKAGVN HDSLVVIYED AGLFSAARAW WMFKAMGFNN VKVLSGGLAK       120
     WLELGLPVES NYTQASLKGD FIAQYRPDYF IDKKQVLSAT KDANTVILDA RAYERFTGKS       180
     SEPRAGMRSG HIINSYSLPL TSLLENGEAK SLDFIQAKFS ELVGNATHLQ FSCGSGVTAC       240
     ALALFADECG YSNLSVYDGS WSEWGADNSL PIAVGG                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page