(data stored in ACNUC7421 zone)

EMBL: CR954246.SUHB

CR954246.SUHB        Location/Qualifiers
FT   CDS             complement(339326..340129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="PSHAa0323"
FT                   /product="inositol-1-monophosphatase"
FT                   /function="3.2 : RNA metabolism"
FT                   /function="3.3.6 : Protein modifications"
FT                   /EC_number="3.1.3.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8002619, 10747806; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85422"
FT                   /db_xref="GOA:Q3ILB4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILB4"
FT                   /protein_id="CAI85422.1"
FT                   /translation="MHPMLNIAVRAARNAGKIILRASEDLSKVEVQQKGTNDLVTNIDK
FT                   EAEAIIRDTILRSYPDHCIVGEELGEHKGKDADYQWIVDPLDGTTNFIKGIPHFAVSIA
FT                   LKVKGRLDQAVIYDPIRGELFTASRGQGAQLNSKRLRVSKTVDLGGSILATGFPFKQKQ
FT                   HLDAYTEAFKALFIHTADIRRAGSAALDMAYVAAGRVDGFFEIGLKPWDTAAGELLVKE
FT                   AGGMVVDFAGGVNYNNSGNIICGAPKLTQAIIREIRPVLTESLLR"
     MHPMLNIAVR AARNAGKIIL RASEDLSKVE VQQKGTNDLV TNIDKEAEAI IRDTILRSYP        60
     DHCIVGEELG EHKGKDADYQ WIVDPLDGTT NFIKGIPHFA VSIALKVKGR LDQAVIYDPI       120
     RGELFTASRG QGAQLNSKRL RVSKTVDLGG SILATGFPFK QKQHLDAYTE AFKALFIHTA       180
     DIRRAGSAAL DMAYVAAGRV DGFFEIGLKP WDTAAGELLV KEAGGMVVDF AGGVNYNNSG       240
     NIICGAPKLT QAIIREIRPV LTESLLR                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page