(data stored in ACNUC7421 zone)

EMBL: CR954246.TESB

CR954246.TESB        Location/Qualifiers
FT   CDS             152407..153264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="PSHAa0141"
FT                   /product="acyl-CoA thioesterase II"
FT                   /function="2.4.1.2 : Degradation"
FT                   /EC_number="3.1.2.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1645722; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85245"
FT                   /db_xref="GOA:Q3IF28"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF28"
FT                   /protein_id="CAI85245.1"
FT                   /translation="MSQVLDDLLSLLTLEEIEQGLYRGQSQDLGFGAVFGGQVMGQALS
FT                   AAKETLPEGRIVHSLHSYFLRPGDATKPIVYDVEAIRDGKSFSTRRVSAIQYGKPIFYM
FT                   TASFQGAEEGLSHQATMPDVPLPEELRSSLEFYKENAEQIPAAIRNQFISEMPIEIRPV
FT                   TFHNPFKPEAMEPVKHIWFKANGEMPDDQRIHNYLLAYASDFEFLPTALQPHGVSFMQP
FT                   NMQVATIDHAMWFHRPFRMDDWILYSVDSPSASSGRGLVRGQFFDRQGNLIASTMQEGV
FT                   MRQR"
     MSQVLDDLLS LLTLEEIEQG LYRGQSQDLG FGAVFGGQVM GQALSAAKET LPEGRIVHSL        60
     HSYFLRPGDA TKPIVYDVEA IRDGKSFSTR RVSAIQYGKP IFYMTASFQG AEEGLSHQAT       120
     MPDVPLPEEL RSSLEFYKEN AEQIPAAIRN QFISEMPIEI RPVTFHNPFK PEAMEPVKHI       180
     WFKANGEMPD DQRIHNYLLA YASDFEFLPT ALQPHGVSFM QPNMQVATID HAMWFHRPFR       240
     MDDWILYSVD SPSASSGRGL VRGQFFDRQG NLIASTMQEG VMRQR                       285
//

If you have problems or comments...

PBIL Back to PBIL home page