(data stored in ACNUC7421 zone)

EMBL: CR954246.TGT

CR954246.TGT         Location/Qualifiers
FT   CDS             334722..335849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="PSHAa0319"
FT                   /product="Queuine tRNA-ribosyltransferase(tRNA-guanine
FT                   transglycosylase)(Guanine insertion enzyme)"
FT                   /function="3.2.3 : RNA modification"
FT                   /EC_number="2.4.2.29"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8323579, 1706703; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85418"
FT                   /db_xref="GOA:Q3ILB8"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILB8"
FT                   /protein_id="CAI85418.1"
FT                   /translation="MKFELDTTDGKARRGRLIFDRGVIETPAFMPVGTYGTVKGMTPDE
FT                   VKATGAQVCLGNTFHLMLRPGTEIIKQHGGLHKFMNWDFPILTDSGGFQVFSLGAMRKI
FT                   TEEGVLFSSPVNGEKIMMTPESSMQVQRDLGSDIVMIFDECTPYPATEKEAKDSMELSL
FT                   RWAKRSKEGHGDNPSALFGIIQGGMYPELRAQSQAGLEEIGFDGYALGGLSVGEPKNEM
FT                   INILDHCAYKMPADKPRYLMGVGKPEDLVESVRRGIDMFDCVMPTRNARNGHLFITTGV
FT                   VKIRNAVHKTDTGPLDPECDCHTCGNYSRAYLHHLDKCNEILGARLNTIHNLRYYQRVM
FT                   EGLRNAISAGKLDEFVQDFYARRGQDVPELADITN"
     MKFELDTTDG KARRGRLIFD RGVIETPAFM PVGTYGTVKG MTPDEVKATG AQVCLGNTFH        60
     LMLRPGTEII KQHGGLHKFM NWDFPILTDS GGFQVFSLGA MRKITEEGVL FSSPVNGEKI       120
     MMTPESSMQV QRDLGSDIVM IFDECTPYPA TEKEAKDSME LSLRWAKRSK EGHGDNPSAL       180
     FGIIQGGMYP ELRAQSQAGL EEIGFDGYAL GGLSVGEPKN EMINILDHCA YKMPADKPRY       240
     LMGVGKPEDL VESVRRGIDM FDCVMPTRNA RNGHLFITTG VVKIRNAVHK TDTGPLDPEC       300
     DCHTCGNYSR AYLHHLDKCN EILGARLNTI HNLRYYQRVM EGLRNAISAG KLDEFVQDFY       360
     ARRGQDVPEL ADITN                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page