(data stored in ACNUC7421 zone)

EMBL: CR954246.THIC

CR954246.THIC        Location/Qualifiers
FT   CDS             497369..499321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="PSHAa0480"
FT                   /product="thiamine biosynthesis protein thiC"
FT                   /function="2.5.10 : Thiamine"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8432721; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85576"
FT                   /db_xref="GOA:Q3IFN9"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFN9"
FT                   /protein_id="CAI85576.1"
FT                   /translation="MSNTAKKSSRRETRAAASEYIYNLTGQPFPNSHKVYVEGTQNNIR
FT                   VGMREITLSDTYIGGSDENPVYEPNEPLRVYDTSGPYTDPNFKLDVRQGLAKFREQWIE
FT                   SRGDTELLESVTSRFTQQRMADEGLDHLRFEHLPKIRRGKAGKNVTQMHYARQGIITPE
FT                   MEYVAIRENMGRKKIHAELLAAQHKGESFGASIPDFITPEFVRDEIARGRAILPNNINH
FT                   PETEPMIVGRNFLVKVNANIGNSSVSSSIEEEVEKMVWSTRWGADTVMDLSTGRYIHET
FT                   REWVVRNSPVPIGTVPIYQALEKVNGVAEDLTWEIFRDTLIEQAEQGVDYFTIHAGVLL
FT                   RYVPMTAKRVTGIVSRGGSIMAKWCLAHHKENFLYTHFEDICEILKQYDICFSLGDGLR
FT                   PGSIADANDEAQFSELRTLGELTKLAWKHDVQVFIEGPGHVPMHMIKANMDEQLKHCDE
FT                   APFYTLGPLTTDIAPGYDHITSGIGAAQIAWYGCAMLCYVTPKEHLGLPNKEDVKEGLI
FT                   TYKIAAHAADLAKGHPGAQERDNALSKARFEFRWHDQFNIGLDPERAREYHDETLPQES
FT                   GKVAHFCSMCGPKFCSMKISQEVREYAKDLEARGIDPANAADTITIKMIDVEAQMKAKS
FT                   DEFKKTGSEIYHKAI"
     MSNTAKKSSR RETRAAASEY IYNLTGQPFP NSHKVYVEGT QNNIRVGMRE ITLSDTYIGG        60
     SDENPVYEPN EPLRVYDTSG PYTDPNFKLD VRQGLAKFRE QWIESRGDTE LLESVTSRFT       120
     QQRMADEGLD HLRFEHLPKI RRGKAGKNVT QMHYARQGII TPEMEYVAIR ENMGRKKIHA       180
     ELLAAQHKGE SFGASIPDFI TPEFVRDEIA RGRAILPNNI NHPETEPMIV GRNFLVKVNA       240
     NIGNSSVSSS IEEEVEKMVW STRWGADTVM DLSTGRYIHE TREWVVRNSP VPIGTVPIYQ       300
     ALEKVNGVAE DLTWEIFRDT LIEQAEQGVD YFTIHAGVLL RYVPMTAKRV TGIVSRGGSI       360
     MAKWCLAHHK ENFLYTHFED ICEILKQYDI CFSLGDGLRP GSIADANDEA QFSELRTLGE       420
     LTKLAWKHDV QVFIEGPGHV PMHMIKANMD EQLKHCDEAP FYTLGPLTTD IAPGYDHITS       480
     GIGAAQIAWY GCAMLCYVTP KEHLGLPNKE DVKEGLITYK IAAHAADLAK GHPGAQERDN       540
     ALSKARFEFR WHDQFNIGLD PERAREYHDE TLPQESGKVA HFCSMCGPKF CSMKISQEVR       600
     EYAKDLEARG IDPANAADTI TIKMIDVEAQ MKAKSDEFKK TGSEIYHKAI                  650
//

If you have problems or comments...

PBIL Back to PBIL home page