(data stored in ACNUC7421 zone)

EMBL: CR954246.THIDE

CR954246.THIDE       Location/Qualifiers
FT   CDS             501391..502917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiDE"
FT                   /locus_tag="PSHAa0484"
FT                   /product="putative phosphomethylpyrimidine
FT                   kinase/thiamin-phosphate pyrophosphorylase"
FT                   /function="2.5.10 : Thiamine"
FT                   /EC_number="2.7.4.7"
FT                   /EC_number="2.5.1.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85580"
FT                   /db_xref="GOA:Q3IFN5"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFN5"
FT                   /protein_id="CAI85580.1"
FT                   /translation="MNNVVWTIAGSDSGGGAGIQADIKAMQSFGVHGCTAITALTAQNS
FT                   LGVEAINAVSTDIIESQLLALEKDMKAKVIKIGMLANVQQIQLISEHISHYKAKWPVPP
FT                   VIVYDPVAIASSGDLLTEEDTVSAIKECLLPLVDVITPNTHETQLLTGVYLIGPAAIKE
FT                   AANKLLSWGAKAVVIKGGHWDYPSGYCIDYCINNFTQKGEEYWLGNEKIQTPHNHGTGC
FT                   SMASVIAACLAKDYPLKDAFILAKAYINQGLKVAVRYGEGIGPVAQTSFPTNLADYPQV
FT                   IEAGSWLGDELDFDVPLDFNMAADFAPCESKSLGLYAVVDSVDWLEKCLQQGVKTVQLR
FT                   VKNKDDAQLDELVAKAVALGEQYNAQVFINDYWQLAIKHGAYGVHLGQQDLENTNLAAI
FT                   KNAGLRLGLSTHGFYEMLRAHNYRPSYLAFGAIYPTTTKDMTGQIQGLEKLFKFVPLMQ
FT                   SYPTVAIGGIDLKRASQVAKTGVGSVAVVRAISEADDYVQAISALQAAIN"
     MNNVVWTIAG SDSGGGAGIQ ADIKAMQSFG VHGCTAITAL TAQNSLGVEA INAVSTDIIE        60
     SQLLALEKDM KAKVIKIGML ANVQQIQLIS EHISHYKAKW PVPPVIVYDP VAIASSGDLL       120
     TEEDTVSAIK ECLLPLVDVI TPNTHETQLL TGVYLIGPAA IKEAANKLLS WGAKAVVIKG       180
     GHWDYPSGYC IDYCINNFTQ KGEEYWLGNE KIQTPHNHGT GCSMASVIAA CLAKDYPLKD       240
     AFILAKAYIN QGLKVAVRYG EGIGPVAQTS FPTNLADYPQ VIEAGSWLGD ELDFDVPLDF       300
     NMAADFAPCE SKSLGLYAVV DSVDWLEKCL QQGVKTVQLR VKNKDDAQLD ELVAKAVALG       360
     EQYNAQVFIN DYWQLAIKHG AYGVHLGQQD LENTNLAAIK NAGLRLGLST HGFYEMLRAH       420
     NYRPSYLAFG AIYPTTTKDM TGQIQGLEKL FKFVPLMQSY PTVAIGGIDL KRASQVAKTG       480
     VGSVAVVRAI SEADDYVQAI SALQAAIN                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page